BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV31036 (740 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_31372| Best HMM Match : Arm (HMM E-Value=0) 72 4e-13 SB_31845| Best HMM Match : Arm (HMM E-Value=3.2e-13) 32 0.56 SB_1853| Best HMM Match : RVT_1 (HMM E-Value=5.99994e-41) 30 1.7 SB_34660| Best HMM Match : AdoHcyase_NAD (HMM E-Value=0.63) 29 4.0 SB_31777| Best HMM Match : Homeobox (HMM E-Value=1.3) 29 5.2 SB_17592| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.2 SB_16471| Best HMM Match : Glyco_transf_8 (HMM E-Value=5.5e-13) 29 5.2 SB_58882| Best HMM Match : EGF_CA (HMM E-Value=0) 29 5.2 SB_37209| Best HMM Match : Ion_trans (HMM E-Value=1.7e-05) 29 5.2 SB_20992| Best HMM Match : ABC_tran (HMM E-Value=1.3e-36) 29 5.2 SB_49935| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.9 SB_31470| Best HMM Match : SAND (HMM E-Value=5e-37) 28 6.9 SB_9496| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.9 SB_52639| Best HMM Match : 7tm_1 (HMM E-Value=0) 28 6.9 SB_47663| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.1 SB_19775| Best HMM Match : Arm (HMM E-Value=0.27) 28 9.1 >SB_31372| Best HMM Match : Arm (HMM E-Value=0) Length = 656 Score = 72.1 bits (169), Expect = 4e-13 Identities = 33/39 (84%), Positives = 35/39 (89%) Frame = +2 Query: 392 ATAPLTELLHSRNEGVATYAAAVLFRMSEDKPHDYKKRL 508 AT PLT+LLHSRNEG+A YAAAVLFRMSEDK DYKKRL Sbjct: 537 ATQPLTDLLHSRNEGIAAYAAAVLFRMSEDKSQDYKKRL 575 Score = 67.7 bits (158), Expect = 9e-12 Identities = 37/68 (54%), Positives = 46/68 (67%), Gaps = 2/68 (2%) Frame = +3 Query: 213 SLAYFSQRKPQQTTIRQQNVIPIFVQLLFNEIENIQRVAAGVLCELAVEKEGAEMIEAEG 392 +L ++ + IR + I +FVQLL++ ENIQRVAAGVLCELA +KEGAE IEAE Sbjct: 477 ALHILAREAHNRAVIRSLHCISLFVQLLYSPNENIQRVAAGVLCELAQDKEGAEAIEAEN 536 Query: 393 --QPLRSL 410 QPL L Sbjct: 537 ATQPLTDL 544 Score = 51.2 bits (117), Expect = 9e-07 Identities = 34/87 (39%), Positives = 47/87 (54%), Gaps = 4/87 (4%) Frame = +1 Query: 1 VKAVVGLVRNLALCSA-NYAPLREHGAVHHLVRLLMRAYND---TQRQRSSSGGGANTAY 168 V G++ NL + N + G + LVR ++A + T+ G N Sbjct: 403 VTCAAGILSNLTCNNPRNKQLVCRFGGIEALVRTCLQAGDREEITEPADMQRRPGHNVVI 462 Query: 169 ADGVRMEEIVEGAVGALHILAKESHNR 249 DGVRM++IVEG VGALHILA+E+HNR Sbjct: 463 -DGVRMDDIVEGTVGALHILAREAHNR 488 >SB_31845| Best HMM Match : Arm (HMM E-Value=3.2e-13) Length = 771 Score = 31.9 bits (69), Expect = 0.56 Identities = 16/66 (24%), Positives = 35/66 (53%) Frame = +3 Query: 210 WSLAYFSQRKPQQTTIRQQNVIPIFVQLLFNEIENIQRVAAGVLCELAVEKEGAEMIEAE 389 W LA+ ++ K + + N + + +L +E +++++ AAGVL E+ ++ Sbjct: 533 WVLAFDNENK--EAILTTPNAVELLKELQHSEDDSVKKAAAGVLWEIEGKESHTVKESTA 590 Query: 390 GQPLRS 407 +PLR+ Sbjct: 591 DEPLRN 596 >SB_1853| Best HMM Match : RVT_1 (HMM E-Value=5.99994e-41) Length = 1069 Score = 30.3 bits (65), Expect = 1.7 Identities = 21/60 (35%), Positives = 30/60 (50%) Frame = +3 Query: 333 GVLCELAVEKEGAEMIEAEGQPLRSLNCCIQEMKGSPRTLQPFCSACPKTSPTITRRDSY 512 G L L +KE AE I AEG+PL S ++ + S + P P+ PT +RD + Sbjct: 192 GGLAILKYKKEFAERIRAEGEPLHSYLSALR-LAYSRAHVPPVVETLPE-DPTDAQRDRH 249 >SB_34660| Best HMM Match : AdoHcyase_NAD (HMM E-Value=0.63) Length = 404 Score = 29.1 bits (62), Expect = 4.0 Identities = 17/60 (28%), Positives = 33/60 (55%), Gaps = 1/60 (1%) Frame = +3 Query: 258 RQQNVIPIFVQLLF-NEIENIQRVAAGVLCELAVEKEGAEMIEAEGQPLRSLNCCIQEMK 434 R N + +++F N + + R+A+ + L +EKE +++ AEG+ R L C++ K Sbjct: 224 RHMNATHLQARIIFRNGLSKLTRLASKHVV-LMLEKEKSQLKNAEGEAKRRLKPCLKTAK 282 >SB_31777| Best HMM Match : Homeobox (HMM E-Value=1.3) Length = 420 Score = 28.7 bits (61), Expect = 5.2 Identities = 10/22 (45%), Positives = 13/22 (59%) Frame = +1 Query: 286 CNCCSMRLKIFSALPPACSVNW 351 CN C + +K +S LPP NW Sbjct: 222 CNACVLLVKRWSKLPPGTEKNW 243 >SB_17592| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 3592 Score = 28.7 bits (61), Expect = 5.2 Identities = 13/20 (65%), Positives = 17/20 (85%) Frame = +1 Query: 172 DGVRMEEIVEGAVGALHILA 231 DG+R ++IV+ AVGALH LA Sbjct: 1727 DGLRGKKIVDVAVGALHCLA 1746 >SB_16471| Best HMM Match : Glyco_transf_8 (HMM E-Value=5.5e-13) Length = 310 Score = 28.7 bits (61), Expect = 5.2 Identities = 11/29 (37%), Positives = 17/29 (58%) Frame = +1 Query: 583 IQDMLGPEQGYEGLYGTRPSFHQQGYDQY 669 +Q LG ++ +EG GT FH G+ Q+ Sbjct: 155 LQRKLGKKETHEGYIGTHTRFHAWGFTQF 183 >SB_58882| Best HMM Match : EGF_CA (HMM E-Value=0) Length = 1027 Score = 28.7 bits (61), Expect = 5.2 Identities = 18/47 (38%), Positives = 22/47 (46%) Frame = +2 Query: 62 CGNTAPFIIWCAC*CVPTTTPRDNAALRAVEPILLTLTAFVWRRSWK 202 C N APF CAC D AL V I L L+ VWR +++ Sbjct: 634 CTNRAPFFK-CACALGSKGNGTDCVALDRVYHINLRLSRTVWRENYR 679 >SB_37209| Best HMM Match : Ion_trans (HMM E-Value=1.7e-05) Length = 822 Score = 28.7 bits (61), Expect = 5.2 Identities = 12/34 (35%), Positives = 20/34 (58%) Frame = -3 Query: 702 YRSQAPASNLSVLIVALLVKGWSGPIQALVTLLW 601 Y+ P N++ I A+L KG+ + +VTL+W Sbjct: 522 YQLPRPVKNVTSDIDAILDKGYDNLLSTMVTLMW 555 >SB_20992| Best HMM Match : ABC_tran (HMM E-Value=1.3e-36) Length = 641 Score = 28.7 bits (61), Expect = 5.2 Identities = 14/34 (41%), Positives = 19/34 (55%), Gaps = 2/34 (5%) Frame = -3 Query: 210 NGAFHDLLHTNA--VSVSSIGSTARRAALSLGVV 115 NG FH L+HTN +SIG R + +GV+ Sbjct: 502 NGMFHSLIHTNMHFFDNNSIGRILNRFSKDIGVI 535 >SB_49935| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 182 Score = 28.3 bits (60), Expect = 6.9 Identities = 13/44 (29%), Positives = 25/44 (56%), Gaps = 1/44 (2%) Frame = +3 Query: 378 IEAEGQPLRSL-NCCIQEMKGSPRTLQPFCSACPKTSPTITRRD 506 ++A+ + LR + N C + +P ++Q P TSP +T++D Sbjct: 61 VQADEEKLREMSNTCEPGLGSAPPSVQTRRKNSPHTSPNLTKKD 104 >SB_31470| Best HMM Match : SAND (HMM E-Value=5e-37) Length = 912 Score = 28.3 bits (60), Expect = 6.9 Identities = 15/55 (27%), Positives = 28/55 (50%) Frame = -3 Query: 192 LLHTNAVSVSSIGSTARRAALSLGVVVGTHQQAHQMMNGAVFPQRSVVGGTERQV 28 L H A + ++ ++ + + + G+H + Q+ AVFP RSV +ER + Sbjct: 763 LQHAKADKMEAVADARQQQFIKVKMKRGSHGKWQQV--AAVFPVRSVTSSSERYI 815 >SB_9496| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2309 Score = 28.3 bits (60), Expect = 6.9 Identities = 13/28 (46%), Positives = 17/28 (60%) Frame = +1 Query: 469 HVRRQAPRLQEETPMELTNSLFRDDHQM 552 HVRRQA +L E T +S+ DHQ+ Sbjct: 1091 HVRRQADQLCERTAPPCQDSMSHRDHQL 1118 >SB_52639| Best HMM Match : 7tm_1 (HMM E-Value=0) Length = 359 Score = 28.3 bits (60), Expect = 6.9 Identities = 10/26 (38%), Positives = 15/26 (57%) Frame = +1 Query: 265 RTSFRYSCNCCSMRLKIFSALPPACS 342 R FR +C CC + +++ L ACS Sbjct: 309 REGFRRACGCCRRQHRVYPGLLVACS 334 >SB_47663| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1409 Score = 27.9 bits (59), Expect = 9.1 Identities = 14/48 (29%), Positives = 24/48 (50%) Frame = +1 Query: 451 CSRSVPHVRRQAPRLQEETPMELTNSLFRDDHQMWSNDLPIQSDIQDM 594 CS VR + Q + P+ N++ DDHQ+ + + +QS + M Sbjct: 114 CSGLKNLVRTRFTLFQTKIPLNTENAVGNDDHQIPTQEKSVQSTVLRM 161 >SB_19775| Best HMM Match : Arm (HMM E-Value=0.27) Length = 607 Score = 27.9 bits (59), Expect = 9.1 Identities = 11/37 (29%), Positives = 23/37 (62%) Frame = +1 Query: 190 EIVEGAVGALHILAKESHNRQLSDSRTSFRYSCNCCS 300 ++ E ++ AL L+K H++ + +R++ + NCCS Sbjct: 541 DVAEQSLTALETLSKR-HSKSILQARSALAIASNCCS 576 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 25,300,160 Number of Sequences: 59808 Number of extensions: 580044 Number of successful extensions: 1928 Number of sequences better than 10.0: 16 Number of HSP's better than 10.0 without gapping: 1587 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1924 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1998111622 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -