BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV31030 (351 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_27773| Best HMM Match : Mito_carr (HMM E-Value=0) 28 1.9 SB_24457| Best HMM Match : TPR_2 (HMM E-Value=1.4e-16) 28 2.4 SB_15233| Best HMM Match : fn3 (HMM E-Value=1.1e-15) 28 2.4 SB_43934| Best HMM Match : Band_41 (HMM E-Value=1.2e-15) 27 3.2 SB_42271| Best HMM Match : DUF229 (HMM E-Value=0) 27 3.2 SB_44755| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 9.9 SB_45519| Best HMM Match : RNB (HMM E-Value=1.6e-35) 26 9.9 SB_19573| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 9.9 >SB_27773| Best HMM Match : Mito_carr (HMM E-Value=0) Length = 203 Score = 28.3 bits (60), Expect = 1.9 Identities = 11/40 (27%), Positives = 22/40 (55%) Frame = +1 Query: 40 CCNIWHWGSVDSISGSRARFQLSGNSGRKHSRCCTSILRK 159 C ++H G+++ I + R Q+ G+ R C TS+ ++ Sbjct: 6 CATVFHDGAMNPIEVIKQRLQMYGSPYRGVIHCATSVFKE 45 >SB_24457| Best HMM Match : TPR_2 (HMM E-Value=1.4e-16) Length = 1134 Score = 27.9 bits (59), Expect = 2.4 Identities = 10/40 (25%), Positives = 19/40 (47%) Frame = -2 Query: 293 LIPNKTEKVRSWSMSRTGDV*HHLMAWGLPWQQQSTVTQC 174 + P+ T + W + D +++ W WQ + VT+C Sbjct: 961 MTPSYTAQSHPWMTTALQDDLDNVLDWSAAWQMEFNVTKC 1000 >SB_15233| Best HMM Match : fn3 (HMM E-Value=1.1e-15) Length = 594 Score = 27.9 bits (59), Expect = 2.4 Identities = 11/28 (39%), Positives = 17/28 (60%) Frame = +1 Query: 52 WHWGSVDSISGSRARFQLSGNSGRKHSR 135 WH S +S++G R R+ +S S H+R Sbjct: 20 WHCYSEESLTGDRRRYNISKQSTLYHTR 47 >SB_43934| Best HMM Match : Band_41 (HMM E-Value=1.2e-15) Length = 378 Score = 27.5 bits (58), Expect = 3.2 Identities = 13/35 (37%), Positives = 18/35 (51%) Frame = +1 Query: 52 WHWGSVDSISGSRARFQLSGNSGRKHSRCCTSILR 156 + W VDSI+ S+A+F S + H T LR Sbjct: 265 YEWPLVDSITASKAKFYFSCATNENHKEQGTVCLR 299 >SB_42271| Best HMM Match : DUF229 (HMM E-Value=0) Length = 591 Score = 27.5 bits (58), Expect = 3.2 Identities = 13/32 (40%), Positives = 19/32 (59%), Gaps = 2/32 (6%) Frame = -2 Query: 347 FFFFFTSHRQIY*KFKC--ILIPNKTEKVRSW 258 FFF+F R+++ KC + I N T+ RSW Sbjct: 141 FFFYFKEARRVFENRKCSVVEIINFTDITRSW 172 >SB_44755| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 317 Score = 25.8 bits (54), Expect = 9.9 Identities = 15/29 (51%), Positives = 16/29 (55%) Frame = +1 Query: 85 SRARFQLSGNSGRKHSRCCTSILRKFSGR 171 SRA LS + K SR C I R FSGR Sbjct: 136 SRAASFLSARAIPKESRGCNCIERVFSGR 164 >SB_45519| Best HMM Match : RNB (HMM E-Value=1.6e-35) Length = 2748 Score = 25.8 bits (54), Expect = 9.9 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +2 Query: 239 HPFSTCSRIGPFL 277 HPF T S IGPFL Sbjct: 431 HPFVTSSEIGPFL 443 >SB_19573| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 554 Score = 25.8 bits (54), Expect = 9.9 Identities = 9/19 (47%), Positives = 13/19 (68%) Frame = +1 Query: 43 CNIWHWGSVDSISGSRARF 99 C + HWGSV + + RAR+ Sbjct: 35 CQVPHWGSVRTFNVCRARY 53 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,732,843 Number of Sequences: 59808 Number of extensions: 207437 Number of successful extensions: 440 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 430 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 440 length of database: 16,821,457 effective HSP length: 73 effective length of database: 12,455,473 effective search space used: 535585339 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -