BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV31030 (351 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF039041-1|AAP46271.1| 1067|Caenorhabditis elegans Laminin relat... 32 0.13 AL021487-10|CAA16357.2| 1592|Caenorhabditis elegans Hypothetical... 31 0.31 U13643-5|AAA21081.1| 89|Caenorhabditis elegans Hypothetical pr... 28 2.2 AF040641-1|AAB94947.2| 203|Caenorhabditis elegans Calponin prot... 26 8.7 AF039038-6|AAK21431.2| 629|Caenorhabditis elegans Hypothetical ... 26 8.7 >AF039041-1|AAP46271.1| 1067|Caenorhabditis elegans Laminin related. see also lmb-protein 1 protein. Length = 1067 Score = 31.9 bits (69), Expect = 0.13 Identities = 15/37 (40%), Positives = 20/37 (54%), Gaps = 2/37 (5%) Frame = +1 Query: 10 SCISGKRGRRC--CNIWHWGSVDSISGSRARFQLSGN 114 +C SG +G RC C HWGS + G+ R +GN Sbjct: 973 NCKSGYQGERCGECAQNHWGSPREVGGTCERCDCNGN 1009 >AL021487-10|CAA16357.2| 1592|Caenorhabditis elegans Hypothetical protein Y45F10B.10 protein. Length = 1592 Score = 30.7 bits (66), Expect = 0.31 Identities = 19/51 (37%), Positives = 25/51 (49%) Frame = -3 Query: 208 YHGSSSQL*HNAAGH*ISVVCLCSSGCASCRYSR*AETEHGSH*WSQQTPS 56 YH +S QL GH +V CLCSS +S S + +SQ TP+ Sbjct: 896 YHIASEQLIGTFKGHTAAVTCLCSSNDSSLFVSTSFDKTVNVWVFSQSTPT 946 >U13643-5|AAA21081.1| 89|Caenorhabditis elegans Hypothetical protein T07E3.2 protein. Length = 89 Score = 27.9 bits (59), Expect = 2.2 Identities = 13/28 (46%), Positives = 16/28 (57%) Frame = +3 Query: 267 DLFCFIWN*NAFKFLINLSMRCKKKKKK 350 DLF I+N F + L + CKKKK K Sbjct: 4 DLFVIIFNFCIITFSVYLGIGCKKKKNK 31 >AF040641-1|AAB94947.2| 203|Caenorhabditis elegans Calponin protein 2 protein. Length = 203 Score = 25.8 bits (54), Expect = 8.7 Identities = 7/25 (28%), Positives = 16/25 (64%) Frame = -2 Query: 80 LMESTDPQCHILQHRRPRLPLMQLE 6 L+E DP C ++ +++P++ +E Sbjct: 68 LIEKLDPSCRVVYNKKPKMAFPMME 92 >AF039038-6|AAK21431.2| 629|Caenorhabditis elegans Hypothetical protein K06A5.1 protein. Length = 629 Score = 25.8 bits (54), Expect = 8.7 Identities = 11/14 (78%), Positives = 12/14 (85%) Frame = +1 Query: 79 SGSRARFQLSGNSG 120 S SR RF+LSGNSG Sbjct: 308 SRSRGRFELSGNSG 321 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 7,877,954 Number of Sequences: 27780 Number of extensions: 148747 Number of successful extensions: 255 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 252 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 255 length of database: 12,740,198 effective HSP length: 72 effective length of database: 10,740,038 effective search space used: 472561672 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -