BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV31028 (765 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_58603| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.1 SB_43151| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.4 SB_34370| Best HMM Match : DUF1656 (HMM E-Value=0.59) 28 9.5 SB_46755| Best HMM Match : zf-C2H2 (HMM E-Value=1.09301e-43) 28 9.5 >SB_58603| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 438 Score = 29.5 bits (63), Expect = 3.1 Identities = 17/52 (32%), Positives = 28/52 (53%), Gaps = 1/52 (1%) Frame = +1 Query: 220 NSSTDAASRAAAHLISQTQFNIDI*HQTT*HRAA-NEYKKQNRFNTSIKIRK 372 + S+ A +AA H+ +T+ + + AA N +K+NR NT K+RK Sbjct: 278 SKSSSTAIKAAMHVHFRTKKREHVTKANDSYNAALNRQRKRNRLNTKTKLRK 329 >SB_43151| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1719 Score = 28.7 bits (61), Expect = 5.4 Identities = 19/63 (30%), Positives = 32/63 (50%), Gaps = 3/63 (4%) Frame = -3 Query: 748 LFI*KI*KKTRYINKKSLIDKEARYKKNRVILIKK--SNSLRL*SFRNC-DREVSKGARG 578 LF+ + + RYINK++ R K+ +L+ S SL+L ++C DR V + Sbjct: 1106 LFLYVVTRTRRYINKRAPESNGCREKRQEKLLVANAHSKSLKLFEKQSCTDRNVKRLCPK 1165 Query: 577 RRC 569 + C Sbjct: 1166 KNC 1168 >SB_34370| Best HMM Match : DUF1656 (HMM E-Value=0.59) Length = 764 Score = 27.9 bits (59), Expect = 9.5 Identities = 20/81 (24%), Positives = 39/81 (48%) Frame = +2 Query: 230 RMLRRVLPRTSYHKRSSI*IYNIRRLNIEPRTNTKNKIDSTHRLKSVSIKANVPIRSRES 409 R +RR + + +R ++ ++RR ++PR + +DS H + S +V ++ +S Sbjct: 196 RHVRRKTLDSRHVRRKTLDSRHVRRKTLDPRHVKRKTLDSRHVRRKPSDSRHVRRKTLDS 255 Query: 410 IHQXXXXXXXXHYMIKCENTL 472 H H ++C NTL Sbjct: 256 RHVRRNTLDSRH--VRC-NTL 273 >SB_46755| Best HMM Match : zf-C2H2 (HMM E-Value=1.09301e-43) Length = 1806 Score = 27.9 bits (59), Expect = 9.5 Identities = 15/32 (46%), Positives = 20/32 (62%), Gaps = 2/32 (6%) Frame = -3 Query: 571 CLEHRAAAAPCVMYLCININYNYNS--PVVFG 482 C +R+ AAPCV+ L I IN++ S V FG Sbjct: 1105 CRPNRSKAAPCVLELKIVINFSSGSYEVVTFG 1136 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,768,746 Number of Sequences: 59808 Number of extensions: 301326 Number of successful extensions: 533 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 470 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 529 length of database: 16,821,457 effective HSP length: 81 effective length of database: 11,977,009 effective search space used: 2072022557 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -