BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV31028 (765 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g43535.1 68415.m05409 trypsin inhibitor, putative similar to ... 31 0.84 >At2g43535.1 68415.m05409 trypsin inhibitor, putative similar to SP|P26780 Trypsin inhibitor 2 precursor (MTI-2) {Sinapis alba} Length = 97 Score = 31.1 bits (67), Expect = 0.84 Identities = 13/38 (34%), Positives = 20/38 (52%) Frame = -3 Query: 619 FRNCDREVSKGARGRRCLEHRAAAAPCVMYLCININYN 506 +RNC ++ KGA G +CL C+ C N ++N Sbjct: 56 YRNCQKD--KGANGGKCLWGEGGKVKCLCDFCSNESFN 91 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,155,449 Number of Sequences: 28952 Number of extensions: 199452 Number of successful extensions: 309 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 303 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 307 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1712086600 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -