BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV31025 (666 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value EF222295-1|ABN79655.1| 146|Tribolium castaneum arginine vasopre... 24 1.3 DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 pro... 23 1.7 AY295880-2|AAQ62694.1| 1558|Tribolium castaneum chitin synthase ... 23 3.0 AY295880-1|AAQ62693.1| 1558|Tribolium castaneum chitin synthase ... 23 3.0 AY291476-1|AAQ55060.1| 1558|Tribolium castaneum chitin synthase ... 23 3.0 AY291475-1|AAQ55059.1| 1558|Tribolium castaneum chitin synthase ... 23 3.0 AJ876407-1|CAI45288.1| 590|Tribolium castaneum phosphatase prot... 22 3.9 >EF222295-1|ABN79655.1| 146|Tribolium castaneum arginine vasopressin-like peptide protein. Length = 146 Score = 23.8 bits (49), Expect = 1.3 Identities = 8/18 (44%), Positives = 12/18 (66%) Frame = +2 Query: 551 GIFGVIIGTKEKIYCNRQ 604 G FG ++GT E + C R+ Sbjct: 64 GPFGCLVGTPETLRCQRE 81 >DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 protein. Length = 2700 Score = 23.4 bits (48), Expect = 1.7 Identities = 7/22 (31%), Positives = 11/22 (50%) Frame = +2 Query: 203 WPVPGCWRSSWAPGRAPPSPGY 268 W P CW+S+ G + P + Sbjct: 756 WNYPVCWQSNCKKGASSDKPNF 777 >AY295880-2|AAQ62694.1| 1558|Tribolium castaneum chitin synthase variant 2 protein. Length = 1558 Score = 22.6 bits (46), Expect = 3.0 Identities = 12/53 (22%), Positives = 22/53 (41%) Frame = +1 Query: 196 QALAGPGVLEKFMGSGTSTSESGIYSRDCTRWTSTRAAREQWRWHWPMPRDSY 354 +AL V++K+ S + Y + RW T + +R + D+Y Sbjct: 811 KALMDDNVMKKYTTSSSEARHYVQYDQGEDRWLCTLLLQRGYRVEYSAASDAY 863 >AY295880-1|AAQ62693.1| 1558|Tribolium castaneum chitin synthase variant 1 protein. Length = 1558 Score = 22.6 bits (46), Expect = 3.0 Identities = 12/53 (22%), Positives = 22/53 (41%) Frame = +1 Query: 196 QALAGPGVLEKFMGSGTSTSESGIYSRDCTRWTSTRAAREQWRWHWPMPRDSY 354 +AL V++K+ S + Y + RW T + +R + D+Y Sbjct: 811 KALMDDNVMKKYTTSSSEARHYVQYDQGEDRWLCTLLLQRGYRVEYSAASDAY 863 >AY291476-1|AAQ55060.1| 1558|Tribolium castaneum chitin synthase CHS1B protein. Length = 1558 Score = 22.6 bits (46), Expect = 3.0 Identities = 12/53 (22%), Positives = 22/53 (41%) Frame = +1 Query: 196 QALAGPGVLEKFMGSGTSTSESGIYSRDCTRWTSTRAAREQWRWHWPMPRDSY 354 +AL V++K+ S + Y + RW T + +R + D+Y Sbjct: 811 KALMDDNVMKKYTTSSSEARHYVQYDQGEDRWLCTLLLQRGYRVEYSAASDAY 863 >AY291475-1|AAQ55059.1| 1558|Tribolium castaneum chitin synthase CHS1A protein. Length = 1558 Score = 22.6 bits (46), Expect = 3.0 Identities = 12/53 (22%), Positives = 22/53 (41%) Frame = +1 Query: 196 QALAGPGVLEKFMGSGTSTSESGIYSRDCTRWTSTRAAREQWRWHWPMPRDSY 354 +AL V++K+ S + Y + RW T + +R + D+Y Sbjct: 811 KALMDDNVMKKYTTSSSEARHYVQYDQGEDRWLCTLLLQRGYRVEYSAASDAY 863 >AJ876407-1|CAI45288.1| 590|Tribolium castaneum phosphatase protein. Length = 590 Score = 22.2 bits (45), Expect = 3.9 Identities = 9/23 (39%), Positives = 13/23 (56%) Frame = +2 Query: 527 LVDLVSELGIFGVIIGTKEKIYC 595 L+ L +LG F ++G E YC Sbjct: 68 LLALAEQLGSFITLVGGPEYAYC 90 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 170,051 Number of Sequences: 336 Number of extensions: 4222 Number of successful extensions: 7 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 17281430 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -