BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV31023 (633 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g52400.1 68414.m05913 glycosyl hydrolase family 1 protein / b... 29 3.4 At5g23740.1 68418.m02784 40S ribosomal protein S11 (RPS11C) 28 4.5 At2g24130.1 68415.m02883 leucine-rich repeat transmembrane prote... 28 4.5 At4g30800.1 68417.m04363 40S ribosomal protein S11 (RPS11B) ribo... 28 5.9 At3g48930.1 68416.m05345 40S ribosomal protein S11 (RPS11A) 28 5.9 At1g54770.1 68414.m06245 expressed protein 27 7.8 >At1g52400.1 68414.m05913 glycosyl hydrolase family 1 protein / beta-glucosidase, putative (BG1) contains Pfam PF00232 : Glycosyl hydrolase family 1 domain; TIGRFAM TIGR01233: 6-phospho-beta-galactosidase; identical to GI:6651430 from [Arabidopsis thaliana] Length = 528 Score = 28.7 bits (61), Expect = 3.4 Identities = 11/33 (33%), Positives = 19/33 (57%) Frame = +2 Query: 266 VGKKPYNTFTLDIYKHATNFLKEYLKQHANSPK 364 +G KP+N LD+Y +L +Y+K + P+ Sbjct: 386 IGSKPFNG-KLDVYSKGLRYLLKYIKDNYGDPE 417 >At5g23740.1 68418.m02784 40S ribosomal protein S11 (RPS11C) Length = 159 Score = 28.3 bits (60), Expect = 4.5 Identities = 14/38 (36%), Positives = 18/38 (47%) Frame = +2 Query: 305 YKHATNFLKEYLKQHANSPKDVQPSGEGKKGSKTIIIQ 418 Y H + Y K+H+N P V P K+G II Q Sbjct: 91 YLHFVKKYQRYEKRHSNIPAHVSPCFRVKEGDHVIIGQ 128 >At2g24130.1 68415.m02883 leucine-rich repeat transmembrane protein kinase, putative Length = 980 Score = 28.3 bits (60), Expect = 4.5 Identities = 19/75 (25%), Positives = 36/75 (48%), Gaps = 2/75 (2%) Frame = -3 Query: 235 VITCCRIRFN**CVTFSRYKNASKQTFLP*YT*QALNL--LLTLCREVSAGFAKLAIVMP 62 + TC + FN + + + + Y+ + L+L L+ +C +V+ G A L P Sbjct: 722 ITTCSKPGFNALVLPLMPNGSLERHLYPGEYSSKNLDLIQLVNICSDVAEGIAYLHHYSP 781 Query: 61 IKYMSCSLFVSSAML 17 +K + C L S+ +L Sbjct: 782 VKVVHCDLKPSNILL 796 >At4g30800.1 68417.m04363 40S ribosomal protein S11 (RPS11B) ribosomal protein S11, Arabidopsis thaliana,PIR2:C35542 Length = 159 Score = 27.9 bits (59), Expect = 5.9 Identities = 13/38 (34%), Positives = 18/38 (47%) Frame = +2 Query: 305 YKHATNFLKEYLKQHANSPKDVQPSGEGKKGSKTIIIQ 418 Y H + Y K+H+N P V P K+G + I Q Sbjct: 91 YLHFVKKYRRYEKRHSNIPAHVSPCFRVKEGDRVTIGQ 128 >At3g48930.1 68416.m05345 40S ribosomal protein S11 (RPS11A) Length = 160 Score = 27.9 bits (59), Expect = 5.9 Identities = 14/38 (36%), Positives = 18/38 (47%) Frame = +2 Query: 305 YKHATNFLKEYLKQHANSPKDVQPSGEGKKGSKTIIIQ 418 Y H + Y K+H+N P V P K+G II Q Sbjct: 91 YLHFVKKYQRYEKRHSNIPAHVSPCFRVKEGDHIIIGQ 128 >At1g54770.1 68414.m06245 expressed protein Length = 189 Score = 27.5 bits (58), Expect = 7.8 Identities = 16/50 (32%), Positives = 23/50 (46%) Frame = +2 Query: 425 SRKHLFEAYKEYGEILEPGVKLMGYSTFERL*KTSFHMLNSPPKNKRYQR 574 SR L E Y + G ++EP + G T + T L S PK Y++ Sbjct: 107 SRSKLAEKYFQIGTVIEPAEEFYGRLTKKNRKATLADELVSDPKTALYRK 156 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,409,121 Number of Sequences: 28952 Number of extensions: 303066 Number of successful extensions: 690 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 676 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 690 length of database: 12,070,560 effective HSP length: 78 effective length of database: 9,812,304 effective search space used: 1295224128 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -