BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV31021 (739 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 11_06_0667 + 26071774-26072070,26072352-26073153,26073209-260734... 29 3.9 02_02_0712 + 13200174-13200761,13201966-13202616 28 6.7 >11_06_0667 + 26071774-26072070,26072352-26073153,26073209-26073411, 26075078-26075521,26075703-26075758,26076323-26076402, 26077098-26077174,26077279-26078301 Length = 993 Score = 29.1 bits (62), Expect = 3.9 Identities = 15/44 (34%), Positives = 27/44 (61%) Frame = -1 Query: 316 ILRNEKLLRLSAIFAILQERH*SLKFGKNMITKHLLQIFEWVNS 185 +L ++ ++RL + +E H SL KNM+ K LL +FE++ + Sbjct: 733 LLHHKHIIRLVGCCVMEEEEHWSLFQKKNMVEKRLL-VFEYMEN 775 >02_02_0712 + 13200174-13200761,13201966-13202616 Length = 412 Score = 28.3 bits (60), Expect = 6.7 Identities = 16/41 (39%), Positives = 22/41 (53%), Gaps = 7/41 (17%) Frame = -3 Query: 107 SESHIPLLD-------VLPTKKNIYLQFYSFHSVTFRTRYQ 6 SESH+PL D ++ + IYL+ Y VT R RY+ Sbjct: 229 SESHVPLFDFPTVYSYLINSTTKIYLESYDLPGVTGRGRYK 269 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,544,357 Number of Sequences: 37544 Number of extensions: 367992 Number of successful extensions: 672 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 661 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 671 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 1945321620 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -