BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV31021 (739 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_51627| Best HMM Match : Sulfotransfer_1 (HMM E-Value=0.017) 32 0.42 SB_59101| Best HMM Match : PT (HMM E-Value=0.026) 28 9.1 >SB_51627| Best HMM Match : Sulfotransfer_1 (HMM E-Value=0.017) Length = 340 Score = 32.3 bits (70), Expect = 0.42 Identities = 28/81 (34%), Positives = 40/81 (49%), Gaps = 6/81 (7%) Frame = +1 Query: 121 FIFVIKGPFYLLILSTIRCF*LSLPIQISEEDV--LLSYFFQILN-FN---GALVKLQKW 282 FI VI+ PF + IR L I+ S+ + S F+IL FN G V ++KW Sbjct: 199 FIHVIRNPFDNISTMLIRTKKLRHDIERSKGKINDTESLEFEILRYFNLAAGNEVLIEKW 258 Query: 283 RLNVIAFHSSILKQRLGSTLR 345 R N++ HS L + T+R Sbjct: 259 RENILEIHSKDLISKPRDTIR 279 >SB_59101| Best HMM Match : PT (HMM E-Value=0.026) Length = 386 Score = 27.9 bits (59), Expect = 9.1 Identities = 16/50 (32%), Positives = 21/50 (42%) Frame = +3 Query: 222 VIIFFPNFKL*WRSCKIAKMALKRNSFSFLNIKATAGEHSKIQRFTNHLF 371 VI F P F W +C A R + LNI T+ H + +H F Sbjct: 71 VIPFSPQFNSYW-NCMAATSNATRTEDASLNITVTSYNHPPVATVVSHAF 119 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 21,782,548 Number of Sequences: 59808 Number of extensions: 433719 Number of successful extensions: 676 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 650 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 676 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1986074805 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -