BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV31020 (600 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_19131| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 1e-21 SB_26178| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.8 SB_56589| Best HMM Match : zf-C4_Topoisom (HMM E-Value=1.1) 28 5.0 SB_54838| Best HMM Match : Vitellogenin_N (HMM E-Value=4.76441e-44) 28 5.0 SB_49314| Best HMM Match : 7tm_1 (HMM E-Value=5.4e-30) 28 6.6 SB_28821| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.8 >SB_19131| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 456 Score = 99 bits (238), Expect = 1e-21 Identities = 45/59 (76%), Positives = 49/59 (83%) Frame = +1 Query: 256 SGVHNMYREYRDLSVGGAVTQCYRDMGARHRARAHSIQIIKVEVIKAAACRRPQVKQFH 432 SG HNMYREYRDL+V GAVT CYRDM ARHRAR +SIQI+KVEVI A+ RRP VKQ H Sbjct: 288 SGTHNMYREYRDLTVSGAVTACYRDMAARHRARGYSIQIMKVEVIPASKARRPHVKQMH 346 Score = 99.5 bits (237), Expect = 2e-21 Identities = 43/80 (53%), Positives = 57/80 (71%) Frame = +2 Query: 14 LREYEVIGRKLPSENEPKPPLYKMRIFSPDPIVAKSRFWYFLRQLKKFKKTTGEIVXXXX 193 L+E++VIGR +P++ PPLYKMRIF+PD +VA+S+FWYF+ QLK+ KK+ GEIV Sbjct: 207 LKEFQVIGRLMPNKKLTVPPLYKMRIFAPDDVVARSKFWYFISQLKRMKKSQGEIVSCQQ 266 Query: 194 XXXXXXXXXXNFGIWLRYES 253 NFGIWLRY+S Sbjct: 267 IYEKKPLQIKNFGIWLRYDS 286 >SB_26178| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 897 Score = 28.7 bits (61), Expect = 3.8 Identities = 12/24 (50%), Positives = 18/24 (75%), Gaps = 1/24 (4%) Frame = +2 Query: 23 YEVIGRKLP-SENEPKPPLYKMRI 91 YEV+G+ + S N+PK PL K+R+ Sbjct: 285 YEVLGKSVNNSRNQPKDPLKKLRV 308 >SB_56589| Best HMM Match : zf-C4_Topoisom (HMM E-Value=1.1) Length = 743 Score = 28.3 bits (60), Expect = 5.0 Identities = 12/38 (31%), Positives = 20/38 (52%) Frame = +1 Query: 430 HNSTIRFPLPKRVHHYKRLNTFAYKRLALTSCNCNVRH 543 HNS +R + ++H+ +TF RLA + +C H Sbjct: 705 HNSRLRLAMSPKLHNPPIDDTFGVNRLAAATTSCIALH 742 >SB_54838| Best HMM Match : Vitellogenin_N (HMM E-Value=4.76441e-44) Length = 2581 Score = 28.3 bits (60), Expect = 5.0 Identities = 19/61 (31%), Positives = 34/61 (55%), Gaps = 5/61 (8%) Frame = +2 Query: 11 QLREYEVIGRKLPSENEPKPPLYKMRIFSPD-----PIVAKSRFWYFLRQLKKFKKTTGE 175 +LR Y++I ++LP+E+E K + +I +P+ VA + W L + K F +TG Sbjct: 1424 KLRLYQIISQRLPTEDENKYD-FVTKISTPNATWEREFVANASLW-LLDEEKSFSISTGA 1481 Query: 176 I 178 + Sbjct: 1482 L 1482 >SB_49314| Best HMM Match : 7tm_1 (HMM E-Value=5.4e-30) Length = 300 Score = 27.9 bits (59), Expect = 6.6 Identities = 15/44 (34%), Positives = 23/44 (52%) Frame = +1 Query: 361 SIQIIKVEVIKAAACRRPQVKQFHNSTIRFPLPKRVHHYKRLNT 492 S++I ++ AC P V HN +R + + VHH KR+ T Sbjct: 246 SLEITCFFLLHVNACCNPVVYSLHNPKLRKCMNRLVHH-KRVRT 288 >SB_28821| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 27.5 bits (58), Expect = 8.8 Identities = 13/43 (30%), Positives = 22/43 (51%) Frame = +1 Query: 409 RPQVKQFHNSTIRFPLPKRVHHYKRLNTFAYKRLALTSCNCNV 537 RP VK FH T++F + H KR N+ + ++ + N + Sbjct: 19 RPTVK-FHQKTVKFHILSVEFHQKRSNSTTFGQIPSSRSNSTI 60 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,523,478 Number of Sequences: 59808 Number of extensions: 382617 Number of successful extensions: 1233 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 1143 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1228 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1451595000 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -