BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV31019X (292 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_31884| Best HMM Match : Rhabdo_M1 (HMM E-Value=0.36) 26 4.6 SB_12476| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 4.6 SB_41418| Best HMM Match : EGF_CA (HMM E-Value=0) 25 8.0 >SB_31884| Best HMM Match : Rhabdo_M1 (HMM E-Value=0.36) Length = 456 Score = 26.2 bits (55), Expect = 4.6 Identities = 11/32 (34%), Positives = 22/32 (68%) Frame = +1 Query: 172 TET*IQEMNYKQNLLACFCKGLLSYIGQIKIM 267 T+ +EM+ K+NLLA FCK ++ + ++ ++ Sbjct: 28 TDAKAEEMSRKRNLLAGFCKLIIYNVFEMPLV 59 >SB_12476| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 102 Score = 26.2 bits (55), Expect = 4.6 Identities = 11/32 (34%), Positives = 22/32 (68%) Frame = +1 Query: 172 TET*IQEMNYKQNLLACFCKGLLSYIGQIKIM 267 T+ +EM+ K+NLLA FCK ++ + ++ ++ Sbjct: 28 TDAKAEEMSRKRNLLAGFCKLIIYNVFEMPLV 59 >SB_41418| Best HMM Match : EGF_CA (HMM E-Value=0) Length = 3312 Score = 25.4 bits (53), Expect = 8.0 Identities = 13/43 (30%), Positives = 26/43 (60%) Frame = +2 Query: 44 DSSVDESQLKGLAKYFNSQTNRGRLNTARATYAVMGAVILYFT 172 +SSV + LK +++Y + ++ +L + T+AV A I ++T Sbjct: 2559 NSSVVKEYLKMMSQYKDQRSEHAQLLSWNETFAVWKAYIDFYT 2601 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 7,470,145 Number of Sequences: 59808 Number of extensions: 113147 Number of successful extensions: 194 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 187 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 194 length of database: 16,821,457 effective HSP length: 70 effective length of database: 12,634,897 effective search space used: 328507322 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -