BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV31016 (765 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_34832| Best HMM Match : SAP (HMM E-Value=1.4e-07) 29 4.1 SB_33107| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.1 SB_28276| Best HMM Match : Cerato-platanin (HMM E-Value=6.7) 28 7.2 SB_933| Best HMM Match : ExoD (HMM E-Value=6) 28 9.5 >SB_34832| Best HMM Match : SAP (HMM E-Value=1.4e-07) Length = 1054 Score = 29.1 bits (62), Expect = 4.1 Identities = 19/71 (26%), Positives = 34/71 (47%), Gaps = 5/71 (7%) Frame = +1 Query: 562 EEPVYGL-MFQEV--KYLLAPLWED--RTAQESPCMWLVLFTKVPRSLVNSFLLMAALTF 726 E P YG +F+ + Y L+ L R + S C+ T P +V + ++ L+ Sbjct: 449 EVPTYGAKIFKRIYQTYQLSQLISKPTRITKSSKCLLDHYVTNSPEKIVKTSVIQLGLSD 508 Query: 727 HGVVLNMESLN 759 HG++L + +N Sbjct: 509 HGMILGIRKIN 519 >SB_33107| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1079 Score = 29.1 bits (62), Expect = 4.1 Identities = 16/41 (39%), Positives = 21/41 (51%) Frame = -1 Query: 501 CSCYRCSRWHFDFPGACGTPACADSDVVNWERFGIRPGYEW 379 C C R + FD GAC T C + + + E F + PGY W Sbjct: 346 CFC-RKNHHRFDRFGACFT--CPNGMICSNETFTLAPGYYW 383 >SB_28276| Best HMM Match : Cerato-platanin (HMM E-Value=6.7) Length = 225 Score = 28.3 bits (60), Expect = 7.2 Identities = 16/52 (30%), Positives = 25/52 (48%), Gaps = 1/52 (1%) Frame = +1 Query: 274 VEIESPGILNGGEYRGFWVRWDSGIISAGREGEAIPFISWSDPEPFPV-YYV 426 + I + GI + + FWV + S + G I W+DP+P V YY+ Sbjct: 1 LNIATSGITSAEKRMVFWVDFRSANLVLGSGATVIA--QWTDPDPLEVGYYI 50 >SB_933| Best HMM Match : ExoD (HMM E-Value=6) Length = 555 Score = 27.9 bits (59), Expect = 9.5 Identities = 14/44 (31%), Positives = 23/44 (52%), Gaps = 1/44 (2%) Frame = +2 Query: 266 PIRLKLKAPEFLTEGNIVVFGFVG-IAALSPLDARVKLFHSYPG 394 P ++ K P L +G I+ GF+G ++AL ++LF G Sbjct: 100 PYVIRPKGPRLLRQGTIMKAGFIGLVSALGVYACNLELFRRCAG 143 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 24,519,016 Number of Sequences: 59808 Number of extensions: 577738 Number of successful extensions: 1644 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 1516 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1643 length of database: 16,821,457 effective HSP length: 81 effective length of database: 11,977,009 effective search space used: 2072022557 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -