BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV31016 (765 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY994095-1|AAX86008.1| 144|Anopheles gambiae unknown protein. 73 1e-14 DQ974163-1|ABJ52803.1| 595|Anopheles gambiae serpin 4B protein. 25 1.9 AJ010299-1|CAA09070.1| 722|Anopheles gambiae stat protein. 23 7.8 >AY994095-1|AAX86008.1| 144|Anopheles gambiae unknown protein. Length = 144 Score = 72.5 bits (170), Expect = 1e-14 Identities = 34/63 (53%), Positives = 38/63 (60%) Frame = +3 Query: 573 IWVDVSGGQVPPGAVVGRQDCSGEPLYVARAVHEGATIPGKLVPSHGCAYVPWGGIEHGK 752 IW S GQVP GAVVG GE LYV RA HEG+ GK+ SH C Y+P+GG E Sbjct: 76 IWDTASAGQVPLGAVVGGHTSDGEILYVGRAYHEGSQTIGKVQCSHNCIYIPYGGAEVSV 135 Query: 753 PQY 761 P Y Sbjct: 136 PTY 138 Score = 48.0 bits (109), Expect = 3e-07 Identities = 23/57 (40%), Positives = 30/57 (52%), Gaps = 1/57 (1%) Frame = +3 Query: 576 WVDVS-GGQVPPGAVVGRQDCSGEPLYVARAVHEGATIPGKLVPSHGCAYVPWGGIE 743 W+ S G PP V G D G ++V RA H G +P K++P AYV +GG E Sbjct: 5 WIPTSVHGPYPPHMVPGGVDSDGAQIFVGRAHHAGDLLPAKVIPDKTAAYVAYGGQE 61 >DQ974163-1|ABJ52803.1| 595|Anopheles gambiae serpin 4B protein. Length = 595 Score = 25.4 bits (53), Expect = 1.9 Identities = 17/45 (37%), Positives = 21/45 (46%) Frame = -1 Query: 366 LASSGDNAAIPTNPKTTIFPSVKNSGAFNFNLIGLGSIFLMTLLA 232 LA+ NA KT IF V +GA + L+G G LLA Sbjct: 34 LAAKIANALSNQKSKTEIFSPVSIAGALSLLLLGSGGQTQQELLA 78 >AJ010299-1|CAA09070.1| 722|Anopheles gambiae stat protein. Length = 722 Score = 23.4 bits (48), Expect = 7.8 Identities = 15/59 (25%), Positives = 24/59 (40%) Frame = +2 Query: 50 TIMANVMDVATDDNLQYQFFPVSSGSVQFKVRAANDAHIALTTGPQESDPMYEVMIGGW 226 T A V TD+N+QY + + F V +ND I+ +++ P W Sbjct: 473 TFSARVGRGLTDENMQYMYRKAYRDKLSFSV--SNDQMISFAQFCKDTTPECNYTFWEW 529 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 807,751 Number of Sequences: 2352 Number of extensions: 19364 Number of successful extensions: 173 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 172 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 173 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 79418373 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -