BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV31016 (765 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g52460.1 68416.m05769 hydroxyproline-rich glycoprotein family... 29 4.5 At1g49760.1 68414.m05580 polyadenylate-binding protein, putative... 29 4.5 At2g30600.2 68415.m03729 BTB/POZ domain-containing protein conta... 28 5.9 At2g30600.1 68415.m03728 BTB/POZ domain-containing protein conta... 28 5.9 At5g41250.1 68418.m05013 exostosin family protein contains Pfam ... 28 7.8 At4g38770.1 68417.m05490 proline-rich family protein (PRP4) simi... 28 7.8 >At3g52460.1 68416.m05769 hydroxyproline-rich glycoprotein family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 300 Score = 28.7 bits (61), Expect = 4.5 Identities = 14/42 (33%), Positives = 21/42 (50%) Frame = -2 Query: 413 GKGSGSDQDMNGIASPSRPAEIMPLSQRTQKPRYSPPLRIPG 288 G G S++D+N P P + P +TQ+ Y P + PG Sbjct: 16 GPGQNSERDIN--QPPPPPPQSQPPPPQTQQQTYPPVMGYPG 55 >At1g49760.1 68414.m05580 polyadenylate-binding protein, putative / PABP, putative similar to poly(A)-binding protein GB:AAF66825 GI:7673359 from [Nicotiana tabacum] Length = 671 Score = 28.7 bits (61), Expect = 4.5 Identities = 20/66 (30%), Positives = 32/66 (48%), Gaps = 2/66 (3%) Frame = -1 Query: 708 EKERVYQGS--WHLREQHEPHTGALLSSPVFPQRRQEVLDLLKHQPIYRLLQTEGVRFLR 535 E++R G + L EQ EP + A ++ + + EVL LL+ + TE + LR Sbjct: 587 EQQRTMLGENLYPLVEQLEPESAAKVTGMLLEMDQTEVLHLLESPEALKAKVTEAMDVLR 646 Query: 534 SLQGSQ 517 S+ Q Sbjct: 647 SVAQQQ 652 >At2g30600.2 68415.m03729 BTB/POZ domain-containing protein contains Pfam PF00651: BTB/POZ domain; contains Interpro IPR000210/ PS50097: BTBB/POZ domain; similar to MigA (GI:1841872) [Dictyostelium discoideum] Length = 809 Score = 28.3 bits (60), Expect = 5.9 Identities = 17/50 (34%), Positives = 26/50 (52%), Gaps = 5/50 (10%) Frame = +1 Query: 310 EYRGFWVRWDSGIISAGREGEAIPF----ISWSDPEP-FPVYYVGVCTGW 444 E++ +W+ G+IS G+ PF W DP+P V YVG+ + W Sbjct: 101 EFQSYWISIYDGLISIGK--GRYPFQNLVFKWQDPKPNCNVQYVGL-SSW 147 >At2g30600.1 68415.m03728 BTB/POZ domain-containing protein contains Pfam PF00651: BTB/POZ domain; contains Interpro IPR000210/ PS50097: BTBB/POZ domain; similar to MigA (GI:1841872) [Dictyostelium discoideum] Length = 809 Score = 28.3 bits (60), Expect = 5.9 Identities = 17/50 (34%), Positives = 26/50 (52%), Gaps = 5/50 (10%) Frame = +1 Query: 310 EYRGFWVRWDSGIISAGREGEAIPF----ISWSDPEP-FPVYYVGVCTGW 444 E++ +W+ G+IS G+ PF W DP+P V YVG+ + W Sbjct: 101 EFQSYWISIYDGLISIGK--GRYPFQNLVFKWQDPKPNCNVQYVGL-SSW 147 >At5g41250.1 68418.m05013 exostosin family protein contains Pfam profile: PF03016 exostosin family Length = 561 Score = 27.9 bits (59), Expect = 7.8 Identities = 12/36 (33%), Positives = 21/36 (58%) Frame = -1 Query: 693 YQGSWHLREQHEPHTGALLSSPVFPQRRQEVLDLLK 586 YQ +WHL E H ++ +S ++R V+++LK Sbjct: 473 YQYAWHLPEDHRKYS-VYISEQDVKEKRVNVVEILK 507 >At4g38770.1 68417.m05490 proline-rich family protein (PRP4) similar to proline-rich protein [Arabidopsis thaliana] gi|6782442|gb|AAF28388; contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 448 Score = 27.9 bits (59), Expect = 7.8 Identities = 9/23 (39%), Positives = 15/23 (65%) Frame = -2 Query: 359 PAEIMPLSQRTQKPRYSPPLRIP 291 P E+ P ++ P+YSPP+ +P Sbjct: 171 PLELPPFLKKPCPPKYSPPVEVP 193 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,220,401 Number of Sequences: 28952 Number of extensions: 406711 Number of successful extensions: 1323 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 1264 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1323 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1712086600 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -