BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV31014 (606 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_19611| Best HMM Match : No HMM Matches (HMM E-Value=.) 142 2e-34 SB_27917| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.9 SB_48343| Best HMM Match : CBF (HMM E-Value=1.3) 28 6.7 SB_28159| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.7 SB_48085| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.7 SB_57193| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.9 SB_44505| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.9 SB_6877| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.9 SB_3212| Best HMM Match : APC10 (HMM E-Value=0.36) 27 8.9 SB_20269| Best HMM Match : SOCS_box (HMM E-Value=4.6e-05) 27 8.9 >SB_19611| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 166 Score = 142 bits (344), Expect = 2e-34 Identities = 65/84 (77%), Positives = 79/84 (94%) Frame = +3 Query: 258 LTVQNRQAQIAVVPSAAALIIRALKEPPRDRKKQKNIKHNGNISLEDVIGIAKIMRNRSM 437 LT+QNRQA+++VVPSA++LII+ALKEPPRDRKK KNIKHNGNI+L+DV +AK+MR RSM Sbjct: 62 LTIQNRQAKVSVVPSASSLIIKALKEPPRDRKKVKNIKHNGNITLDDVTNVAKVMRPRSM 121 Query: 438 ARYLSGSVKEILGTAQSVGCTVEG 509 AR+LSG+VKEILGT QSVGCTV+G Sbjct: 122 ARHLSGTVKEILGTCQSVGCTVDG 145 Score = 118 bits (285), Expect = 3e-27 Identities = 54/60 (90%), Positives = 56/60 (93%) Frame = +1 Query: 76 MPPKFDPNEIKIVNLRCVGGEVGATSSLAPKIGPLGLSPKKVGDDIAKATSDWKGLKITV 255 MPPKFDPNEI+ V LRC GGEVGAT+SLAPKIGPLGLSPKKVGDDIAKAT DWKGLKITV Sbjct: 1 MPPKFDPNEIQYVYLRCTGGEVGATASLAPKIGPLGLSPKKVGDDIAKATQDWKGLKITV 60 Score = 29.5 bits (63), Expect = 2.2 Identities = 11/20 (55%), Positives = 15/20 (75%) Frame = +2 Query: 506 GRPPHDLIDDINSGALTIDE 565 G PHD+ID INSG + I++ Sbjct: 145 GMAPHDVIDKINSGEIEIED 164 >SB_27917| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 4554 Score = 28.7 bits (61), Expect = 3.9 Identities = 22/61 (36%), Positives = 29/61 (47%) Frame = -2 Query: 323 SDDKGCCRGNNSYLGLSVLNCQLTVILRPFQSLVALAMSSPTFLGDRPRGPILGAKDDVA 144 SD+K C R S L + LT++ P + S TF +P GP+ G K DVA Sbjct: 924 SDEKRCIRAFLSSLRNPSDDEVLTLMALPIFEAI-----SGTFTAVQPDGPLRGEKLDVA 978 Query: 143 P 141 P Sbjct: 979 P 979 >SB_48343| Best HMM Match : CBF (HMM E-Value=1.3) Length = 669 Score = 27.9 bits (59), Expect = 6.7 Identities = 19/61 (31%), Positives = 35/61 (57%), Gaps = 2/61 (3%) Frame = +3 Query: 360 KNIKHNGNISLEDVIGIAKIMRNRSMARYLSGSVKEILGTAQ--SVGCTVEGGRHMILLM 533 + I+ + SL+ ++GIA+++RN MA Y+ + +LGT+ VG R+ ++ M Sbjct: 39 EKIERHKKTSLQGLMGIAQMIRN--MAGYVDDLWEILLGTSTPLPVGVLTTEERNALVKM 96 Query: 534 T 536 T Sbjct: 97 T 97 >SB_28159| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 491 Score = 27.9 bits (59), Expect = 6.7 Identities = 9/23 (39%), Positives = 15/23 (65%) Frame = +1 Query: 172 GPLGLSPKKVGDDIAKATSDWKG 240 GPLG+ +++ D ++SDW G Sbjct: 337 GPLGMEDRRIQDSQINSSSDWDG 359 >SB_48085| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 27.9 bits (59), Expect = 6.7 Identities = 15/82 (18%), Positives = 34/82 (41%) Frame = +3 Query: 267 QNRQAQIAVVPSAAALIIRALKEPPRDRKKQKNIKHNGNISLEDVIGIAKIMRNRSMARY 446 Q ++ V A +++ + P+ + KN+ H + D + R+ + + Sbjct: 74 QKMDTRVIAVLFVAIMVLSSTNALPKQKGSYKNMNHADFLKGLDRASSKRDCRDSHWSCF 133 Query: 447 LSGSVKEILGTAQSVGCTVEGG 512 + ++I TAQ+ C + G Sbjct: 134 FQSNYEDICSTAQAEECALSCG 155 >SB_57193| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 193 Score = 27.5 bits (58), Expect = 8.9 Identities = 13/33 (39%), Positives = 21/33 (63%) Frame = -1 Query: 588 YIDIRNIYSSMVKAPLLMSSIRSCGGLPPQYIQ 490 Y+D+ + YS++VKAP L+ R+ P Y+Q Sbjct: 25 YVDLADSYSTIVKAPSLLQPART-----PPYLQ 52 >SB_44505| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 490 Score = 27.5 bits (58), Expect = 8.9 Identities = 15/38 (39%), Positives = 19/38 (50%), Gaps = 2/38 (5%) Frame = -2 Query: 239 PFQSLVALAMSS--PTFLGDRPRGPILGAKDDVAPTSP 132 PF +L+ SS F+ DRPRGP G D + P Sbjct: 360 PFNALIVGPTSSGKTRFIVDRPRGPFRGKFDYIVLVCP 397 >SB_6877| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 422 Score = 27.5 bits (58), Expect = 8.9 Identities = 14/49 (28%), Positives = 26/49 (53%) Frame = -2 Query: 272 VLNCQLTVILRPFQSLVALAMSSPTFLGDRPRGPILGAKDDVAPTSPPT 126 V +C T+++RP +++ A ++PT RGP + + + PPT Sbjct: 103 VSSCLATLLVRPLETIPAPTPTTPTSPATPARGPPI--RTPIPLKEPPT 149 >SB_3212| Best HMM Match : APC10 (HMM E-Value=0.36) Length = 646 Score = 27.5 bits (58), Expect = 8.9 Identities = 14/37 (37%), Positives = 19/37 (51%) Frame = +1 Query: 94 PNEIKIVNLRCVGGEVGATSSLAPKIGPLGLSPKKVG 204 P+ +L+C G E TSS+ P +G LG K G Sbjct: 597 PSMTNTTSLKCQGDEKSGTSSITP-LGSLGTYDKSHG 632 >SB_20269| Best HMM Match : SOCS_box (HMM E-Value=4.6e-05) Length = 302 Score = 27.5 bits (58), Expect = 8.9 Identities = 14/34 (41%), Positives = 19/34 (55%) Frame = +3 Query: 273 RQAQIAVVPSAAALIIRALKEPPRDRKKQKNIKH 374 RQ + +PSA IR +E PR +K N+KH Sbjct: 107 RQVEPLPLPSALKEWIREYEEEPRFDRKLTNLKH 140 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 19,325,498 Number of Sequences: 59808 Number of extensions: 406706 Number of successful extensions: 1034 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 979 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1034 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1475788250 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -