BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV31007 (812 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_31262| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.21 SB_52408| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.48 SB_27215| Best HMM Match : PPR (HMM E-Value=3.2) 29 3.4 SB_47082| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.9 >SB_31262| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 358 Score = 33.5 bits (73), Expect = 0.21 Identities = 17/40 (42%), Positives = 24/40 (60%) Frame = +1 Query: 415 SVTPKTKPARKSPGSLPPCWKTTEFTSRSCPRGQTVPEAR 534 S++P + R S GSL P +T+ TSRS PR ++ AR Sbjct: 179 SISPASPALRSSLGSLAPTSRTSTPTSRSTPRSRSRSRAR 218 >SB_52408| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 673 Score = 32.3 bits (70), Expect = 0.48 Identities = 21/91 (23%), Positives = 43/91 (47%) Frame = +2 Query: 323 DLHRADCQAHKQKGPSRPQVDRPTKPQQNCIR*LQRQNQQESLLEVYPRVGKQQSLLQDH 502 DLH + Q +Q G + + + QQ ++ Q+Q QQ+ L + ++QS +++ Sbjct: 558 DLHEEEVQHQQQFGLQEQSLGQEQRKQQQQLQQQQQQKQQQQL----QKKQQKQSSMEEK 613 Query: 503 VHEDKQYLKLDNTKGSSDDRIIYGDSTADTF 595 + + + + L GSS + + + D F Sbjct: 614 LSSEIEKMTLATGDGSSKEGSLMDPVSVDEF 644 >SB_27215| Best HMM Match : PPR (HMM E-Value=3.2) Length = 603 Score = 29.5 bits (63), Expect = 3.4 Identities = 17/63 (26%), Positives = 32/63 (50%) Frame = -2 Query: 628 VHGGLKVPVVFEGVSGAITVDDTVITRTFRVIELQVLFVLVDMILK*TLLFSNTGVNFQE 449 ++ G K +VF+ VS ++ + ++ + V FVLV ++ L F + +NF+E Sbjct: 283 INSGKKAEMVFDYVSDSLELQESFWRFFVPEHSISVPFVLVGHTVEPALSFDRSHINFRE 342 Query: 448 TFL 440 L Sbjct: 343 MLL 345 >SB_47082| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 908 Score = 28.7 bits (61), Expect = 5.9 Identities = 16/46 (34%), Positives = 25/46 (54%), Gaps = 1/46 (2%) Frame = +2 Query: 659 REYNSVMTLDEDMAANEDREALGHSGE-VSGYPQLLHGTSSPTKRC 793 RE NS+ +L D++ N ++ A+G E VS + +P KRC Sbjct: 764 RENNSINSLPLDISQNREKAAMGLVNEDVSPEKFAVESGETPPKRC 809 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 26,019,631 Number of Sequences: 59808 Number of extensions: 557275 Number of successful extensions: 1909 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 1730 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1905 length of database: 16,821,457 effective HSP length: 81 effective length of database: 11,977,009 effective search space used: 2263654701 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -