BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV31007 (812 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AF069739-1|AAC63272.2| 690|Apis mellifera translation initiatio... 25 1.1 DQ855484-1|ABH88171.1| 130|Apis mellifera chemosensory protein ... 24 1.5 AJ973401-1|CAJ01448.1| 130|Apis mellifera hypothetical protein ... 24 1.5 AF481963-1|AAN59784.1| 130|Apis mellifera antennal-specific pro... 24 1.5 DQ013068-1|AAY81956.1| 931|Apis mellifera dusty protein kinase ... 22 7.8 DQ013067-1|AAY81955.1| 969|Apis mellifera dusty protein kinase ... 22 7.8 >AF069739-1|AAC63272.2| 690|Apis mellifera translation initiation factor 2 protein. Length = 690 Score = 24.6 bits (51), Expect = 1.1 Identities = 13/48 (27%), Positives = 22/48 (45%) Frame = +3 Query: 270 TKDGKEIVKSYFPIQFRVIFTEQTVKLINKRDHHALKLIDQQNHNKIA 413 T + K+I K P + ++I V ++ DH L+D + IA Sbjct: 124 TMENKDITKRPLPNESQLIKRHPIVTIMGHVDHGKTTLLDALRNTSIA 171 >DQ855484-1|ABH88171.1| 130|Apis mellifera chemosensory protein 3 protein. Length = 130 Score = 24.2 bits (50), Expect = 1.5 Identities = 11/27 (40%), Positives = 18/27 (66%) Frame = +1 Query: 151 AIAKCSEYLKEKKGEVIKEAVKRLIEN 231 A+A + +K+ EVIK+ +K L+EN Sbjct: 71 ALATDCKKCTDKQREVIKKVIKFLVEN 97 >AJ973401-1|CAJ01448.1| 130|Apis mellifera hypothetical protein protein. Length = 130 Score = 24.2 bits (50), Expect = 1.5 Identities = 11/27 (40%), Positives = 18/27 (66%) Frame = +1 Query: 151 AIAKCSEYLKEKKGEVIKEAVKRLIEN 231 A+A + +K+ EVIK+ +K L+EN Sbjct: 71 ALATDCKKCTDKQREVIKKVIKFLVEN 97 >AF481963-1|AAN59784.1| 130|Apis mellifera antennal-specific protein 3c precursor protein. Length = 130 Score = 24.2 bits (50), Expect = 1.5 Identities = 11/27 (40%), Positives = 18/27 (66%) Frame = +1 Query: 151 AIAKCSEYLKEKKGEVIKEAVKRLIEN 231 A+A + +K+ EVIK+ +K L+EN Sbjct: 71 ALATDCKKCTDKQREVIKKVIKFLVEN 97 >DQ013068-1|AAY81956.1| 931|Apis mellifera dusty protein kinase isoform B protein. Length = 931 Score = 21.8 bits (44), Expect = 7.8 Identities = 9/25 (36%), Positives = 11/25 (44%) Frame = +2 Query: 233 ARGTPWTCLPVMDKGWKGNRQILLP 307 A PW+ LP+ D N I P Sbjct: 88 ANEKPWSTLPIEDLTKSDNEDITYP 112 >DQ013067-1|AAY81955.1| 969|Apis mellifera dusty protein kinase isoform A protein. Length = 969 Score = 21.8 bits (44), Expect = 7.8 Identities = 9/25 (36%), Positives = 11/25 (44%) Frame = +2 Query: 233 ARGTPWTCLPVMDKGWKGNRQILLP 307 A PW+ LP+ D N I P Sbjct: 126 ANEKPWSTLPIEDLTKSDNEDITYP 150 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 224,199 Number of Sequences: 438 Number of extensions: 4892 Number of successful extensions: 13 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 13 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 13 length of database: 146,343 effective HSP length: 57 effective length of database: 121,377 effective search space used: 25853301 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -