BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV31005X (476 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ667183-1|ABG75735.1| 463|Apis mellifera GABA-gated ion channe... 22 2.9 DQ026031-1|AAY87890.1| 601|Apis mellifera nicotinic acetylcholi... 21 6.8 >DQ667183-1|ABG75735.1| 463|Apis mellifera GABA-gated ion channel protein. Length = 463 Score = 22.2 bits (45), Expect = 2.9 Identities = 9/23 (39%), Positives = 14/23 (60%) Frame = +1 Query: 256 EIIEVSIAPKPQKVSAADHAQLT 324 E+I +S P+P K A H Q++ Sbjct: 366 EVIPLSAIPEPSKNPAMGHWQMS 388 >DQ026031-1|AAY87890.1| 601|Apis mellifera nicotinic acetylcholine receptor alpha1subunit protein. Length = 601 Score = 21.0 bits (42), Expect = 6.8 Identities = 16/62 (25%), Positives = 34/62 (54%), Gaps = 2/62 (3%) Frame = +1 Query: 262 IEVSIAPKPQKVSAADHAQLTDLLLSEHGELIQTLDLADEQ--AKIQQKMNELKAEVDSK 435 I +AP P + ++ +L D LLS + LI+ + ++ K+ ++++L +V+ K Sbjct: 5 ISCLVAPFPGASANSEAKRLYDDLLSNYNRLIRPVGNNSDRLTVKMGLRLSQL-IDVNLK 63 Query: 436 DQ 441 +Q Sbjct: 64 NQ 65 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 123,410 Number of Sequences: 438 Number of extensions: 2351 Number of successful extensions: 2 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2 length of database: 146,343 effective HSP length: 53 effective length of database: 123,129 effective search space used: 12928545 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -