BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV31004 (725 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AC006729-6|AAF60464.1| 282|Caenorhabditis elegans Hypothetical ... 30 1.5 X91803-1|CAA62913.1| 880|Caenorhabditis elegans sodium-calcium ... 29 3.4 AL132858-14|CAJ90511.1| 873|Caenorhabditis elegans Hypothetical... 29 3.4 AL132858-13|CAB60477.1| 880|Caenorhabditis elegans Hypothetical... 29 3.4 U39652-2|AAA80404.1| 817|Caenorhabditis elegans Hypothetical pr... 28 7.8 >AC006729-6|AAF60464.1| 282|Caenorhabditis elegans Hypothetical protein Y24D9A.5 protein. Length = 282 Score = 30.3 bits (65), Expect = 1.5 Identities = 16/39 (41%), Positives = 21/39 (53%), Gaps = 1/39 (2%) Frame = -2 Query: 208 VALGASAGREHQRPRQLDIHRVRPHRHHYRKI-FHQAYP 95 +AL A REH R+ + VR HRHH+R + H P Sbjct: 40 LALSRRALREHSLCRRDENGTVRTHRHHHRAVAAHNTVP 78 >X91803-1|CAA62913.1| 880|Caenorhabditis elegans sodium-calcium exchanger protein. Length = 880 Score = 29.1 bits (62), Expect = 3.4 Identities = 16/43 (37%), Positives = 22/43 (51%), Gaps = 1/43 (2%) Frame = -2 Query: 136 HRHHYRKIFHQAYPDDVDAP-VRNEEVLQNVEVGNQMKNQSHW 11 HR HY IF Q + DAP V E+ VG Q K+++ + Sbjct: 311 HRRHYLDIFKQLRSEHPDAPVVELEKHAMEKVVGEQKKSRAFY 353 >AL132858-14|CAJ90511.1| 873|Caenorhabditis elegans Hypothetical protein Y113G7A.4b protein. Length = 873 Score = 29.1 bits (62), Expect = 3.4 Identities = 16/43 (37%), Positives = 22/43 (51%), Gaps = 1/43 (2%) Frame = -2 Query: 136 HRHHYRKIFHQAYPDDVDAP-VRNEEVLQNVEVGNQMKNQSHW 11 HR HY IF Q + DAP V E+ VG Q K+++ + Sbjct: 311 HRRHYLDIFKQLRSEHPDAPVVELEKHAMEKVVGEQKKSRAFY 353 >AL132858-13|CAB60477.1| 880|Caenorhabditis elegans Hypothetical protein Y113G7A.4a protein. Length = 880 Score = 29.1 bits (62), Expect = 3.4 Identities = 16/43 (37%), Positives = 22/43 (51%), Gaps = 1/43 (2%) Frame = -2 Query: 136 HRHHYRKIFHQAYPDDVDAP-VRNEEVLQNVEVGNQMKNQSHW 11 HR HY IF Q + DAP V E+ VG Q K+++ + Sbjct: 311 HRRHYLDIFKQLRSEHPDAPVVELEKHAMEKVVGEQKKSRAFY 353 >U39652-2|AAA80404.1| 817|Caenorhabditis elegans Hypothetical protein R07E4.5 protein. Length = 817 Score = 27.9 bits (59), Expect = 7.8 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = +1 Query: 67 HYAQVHPHHQDM 102 HY Q HPHHQ M Sbjct: 764 HYTQPHPHHQQM 775 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,297,046 Number of Sequences: 27780 Number of extensions: 320463 Number of successful extensions: 845 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 816 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 845 length of database: 12,740,198 effective HSP length: 79 effective length of database: 10,545,578 effective search space used: 1708383636 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -