BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV31003 (617 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value EF125543-1|ABL73927.1| 475|Tribolium castaneum chitinase 4 prot... 25 0.67 AY675073-1|AAV74190.1| 533|Tribolium castaneum chitinase 5 prot... 23 1.6 AM292354-1|CAL23166.1| 321|Tribolium castaneum gustatory recept... 22 3.6 >EF125543-1|ABL73927.1| 475|Tribolium castaneum chitinase 4 protein. Length = 475 Score = 24.6 bits (51), Expect = 0.67 Identities = 15/52 (28%), Positives = 22/52 (42%), Gaps = 2/52 (3%) Frame = +2 Query: 59 LSRSVKLCNTRLED--DELQGLPPRHQGLVRSQVPHTWNYSALHVHESVQSW 208 LS+ + + N D G+ H GL S V T N L V +++ W Sbjct: 195 LSKYLDIINVMAYDLRGSWDGVTGHHSGLYPSAVDTTTNQKLLTVDAAIRGW 246 >AY675073-1|AAV74190.1| 533|Tribolium castaneum chitinase 5 protein. Length = 533 Score = 23.4 bits (48), Expect = 1.6 Identities = 19/66 (28%), Positives = 30/66 (45%), Gaps = 3/66 (4%) Frame = +2 Query: 155 PHT-WNYSALHVHESVQSWRHCRHQRQWCSSKGYAHKV-YHGKTGRVYNV-TAHALGVIV 325 PH W Y L+V++ +Q W CS K + ++G+T + N T + G + Sbjct: 234 PHDQWAYEKLNVNDGLQLW-----VDYGCSPKKLIVGIPFYGRTFTLSNSNTNYNPGTYI 288 Query: 326 NKRVRG 343 NK G Sbjct: 289 NKEAGG 294 >AM292354-1|CAL23166.1| 321|Tribolium castaneum gustatory receptor candidate 33 protein. Length = 321 Score = 22.2 bits (45), Expect = 3.6 Identities = 6/14 (42%), Positives = 9/14 (64%) Frame = -3 Query: 591 IFYWTLRYEFVWDR 550 ++YW +YE W R Sbjct: 119 VYYWRQQYEDFWHR 132 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 136,918 Number of Sequences: 336 Number of extensions: 2855 Number of successful extensions: 4 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of database: 122,585 effective HSP length: 54 effective length of database: 104,441 effective search space used: 15770591 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -