BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV31003 (617 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value M93690-2|AAA29363.1| 1212|Anopheles gambiae unknown protein. 29 0.12 AB090813-2|BAC57902.1| 1099|Anopheles gambiae reverse transcript... 24 3.4 AY353563-1|AAQ57599.1| 1132|Anopheles gambiae relish protein. 24 4.5 DQ219482-1|ABB29886.1| 545|Anopheles gambiae cryptochrome 1 pro... 23 6.0 AB090819-2|BAC57914.1| 1022|Anopheles gambiae reverse transcript... 23 6.0 >M93690-2|AAA29363.1| 1212|Anopheles gambiae unknown protein. Length = 1212 Score = 29.1 bits (62), Expect = 0.12 Identities = 14/42 (33%), Positives = 22/42 (52%) Frame = +2 Query: 401 RQDFLKRVKENERLLKEAKAAGKTVNLKRQPAPPKAPTSSVE 526 R++ +R +E +L EA A + N + QP PP P + E Sbjct: 1101 REEDERRTEERRQLHNEANRAYRQRNRRSQPTPPAPPPTPRE 1142 >AB090813-2|BAC57902.1| 1099|Anopheles gambiae reverse transcriptase protein. Length = 1099 Score = 24.2 bits (50), Expect = 3.4 Identities = 15/59 (25%), Positives = 24/59 (40%) Frame = +2 Query: 377 EHVKHSKCRQDFLKRVKENERLLKEAKAAGKTVNLKRQPAPPKAPTSSVELRNPSYLRL 553 E V + R+ ++R + + R A + L+R PP P S + LRL Sbjct: 1028 EEVADLEARRAEIRRARNDRRNASRRAARARQRELQRAGRPPSPPPSPRTAARRADLRL 1086 >AY353563-1|AAQ57599.1| 1132|Anopheles gambiae relish protein. Length = 1132 Score = 23.8 bits (49), Expect = 4.5 Identities = 10/34 (29%), Positives = 18/34 (52%) Frame = +2 Query: 386 KHSKCRQDFLKRVKENERLLKEAKAAGKTVNLKR 487 KH C + +E +++ KEA +T+NL + Sbjct: 323 KHRLCELNREPTEREEQQMQKEAAVMARTMNLNQ 356 >DQ219482-1|ABB29886.1| 545|Anopheles gambiae cryptochrome 1 protein. Length = 545 Score = 23.4 bits (48), Expect = 6.0 Identities = 10/32 (31%), Positives = 15/32 (46%) Frame = +1 Query: 250 VCTQSIPWKDRSRVQRDCSCSRCDCQQACSRK 345 VC + W S +R S+C C A +R+ Sbjct: 412 VCAGNWMWVSSSAFERLLDSSKCTCPIALARR 443 >AB090819-2|BAC57914.1| 1022|Anopheles gambiae reverse transcriptase protein. Length = 1022 Score = 23.4 bits (48), Expect = 6.0 Identities = 10/21 (47%), Positives = 13/21 (61%) Frame = -2 Query: 241 TAPLPLMSTMSPTLYTFMYVE 179 TA +P S + PTL+ MY E Sbjct: 607 TAGVPQGSVLGPTLWNLMYNE 627 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 628,392 Number of Sequences: 2352 Number of extensions: 13121 Number of successful extensions: 80 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 79 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 80 length of database: 563,979 effective HSP length: 61 effective length of database: 420,507 effective search space used: 60553008 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -