BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV31001 (530 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_6482| Best HMM Match : No HMM Matches (HMM E-Value=.) 140 9e-34 SB_49538| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 2e-11 SB_30426| Best HMM Match : CXC (HMM E-Value=2.8) 28 4.1 SB_48733| Best HMM Match : RVT_1 (HMM E-Value=5.2e-05) 28 5.4 SB_28852| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.4 SB_6924| Best HMM Match : TTL (HMM E-Value=4.4e-09) 28 5.4 SB_37962| Best HMM Match : Tcp10_C (HMM E-Value=5.9e-36) 27 7.2 SB_30168| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.2 SB_3781| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.2 >SB_6482| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 153 Score = 140 bits (338), Expect = 9e-34 Identities = 61/78 (78%), Positives = 75/78 (96%) Frame = +2 Query: 23 MSLVIPDKFQHILRIMNTNIDGKRKVMFAMTAIKGVGRRYSNIVLKKADIDLDKRAGECT 202 MSLVIP+KFQHILR++NTNIDGK+K+MFAMT+IKGVGRRY+NIV KKADID++KRAGE T Sbjct: 1 MSLVIPEKFQHILRVLNTNIDGKQKIMFAMTSIKGVGRRYANIVCKKADIDMNKRAGELT 60 Query: 203 EEEVEKIITIMSNPRQYR 256 E+EVE+++TIM NPRQY+ Sbjct: 61 EDEVERVVTIMQNPRQYK 78 Score = 111 bits (266), Expect = 5e-25 Identities = 47/57 (82%), Positives = 53/57 (92%) Frame = +1 Query: 256 IPDWFLNRQKDIVDGKYSQLTSSNLDSKLREDLERLKKIRAHRGMRHYWGLRVRGQH 426 IPDWFLNRQKD DGKYSQ+ ++ LD+K+REDLERLKKIRAHRG+RHYWGLRVRGQH Sbjct: 79 IPDWFLNRQKDHKDGKYSQILANGLDNKMREDLERLKKIRAHRGLRHYWGLRVRGQH 135 >SB_49538| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 34 Score = 66.1 bits (154), Expect = 2e-11 Identities = 28/34 (82%), Positives = 34/34 (100%) Frame = +2 Query: 23 MSLVIPDKFQHILRIMNTNIDGKRKVMFAMTAIK 124 MSLVIP+KFQHILR++NTNIDGK+K+MFAMT+IK Sbjct: 1 MSLVIPEKFQHILRVLNTNIDGKQKIMFAMTSIK 34 >SB_30426| Best HMM Match : CXC (HMM E-Value=2.8) Length = 410 Score = 28.3 bits (60), Expect = 4.1 Identities = 17/63 (26%), Positives = 31/63 (49%), Gaps = 4/63 (6%) Frame = -2 Query: 196 FASTLVKINVGFFENNVGVPPANTFDSRHRKHNLSFAIDVRIHDTKNMLKFVW----NDQ 29 + +T+ + + E VG+ N F +R+R H SF + ++ + K++W ND Sbjct: 313 YQATVTRKDKNTSETYVGLTE-NAFKTRYRNHTASFR-HAKHRNSTELSKYIWSLKDNDI 370 Query: 28 RHF 20 HF Sbjct: 371 EHF 373 >SB_48733| Best HMM Match : RVT_1 (HMM E-Value=5.2e-05) Length = 1104 Score = 27.9 bits (59), Expect = 5.4 Identities = 10/37 (27%), Positives = 23/37 (62%) Frame = -3 Query: 213 TSSSVHSPARLSRSMSAFLRTMLEYLRPTPLIAVIAN 103 T +++HS + ++++ F+ + +E RPT L ++ N Sbjct: 826 TDTALHSKGKDNKTLDLFVSSRVEKYRPTKLHEIVGN 862 >SB_28852| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 3172 Score = 27.9 bits (59), Expect = 5.4 Identities = 14/41 (34%), Positives = 22/41 (53%) Frame = +1 Query: 259 PDWFLNRQKDIVDGKYSQLTSSNLDSKLREDLERLKKIRAH 381 PD LN KD +GK T+ + ++L D ++ K R+H Sbjct: 663 PDPSLNVNKDSEEGKTQAQTTDEIIAQLISDHKKKKNARSH 703 >SB_6924| Best HMM Match : TTL (HMM E-Value=4.4e-09) Length = 458 Score = 27.9 bits (59), Expect = 5.4 Identities = 17/61 (27%), Positives = 30/61 (49%) Frame = +2 Query: 44 KFQHILRIMNTNIDGKRKVMFAMTAIKGVGRRYSNIVLKKADIDLDKRAGECTEEEVEKI 223 +F+H ++ + KRK + + +NI K DIDL G CTE+E+ ++ Sbjct: 59 EFRHEVQASTRKVSSKRKPIRKRRTVT------ANISATKYDIDL---LGYCTEQEIRRV 109 Query: 224 I 226 + Sbjct: 110 V 110 >SB_37962| Best HMM Match : Tcp10_C (HMM E-Value=5.9e-36) Length = 1290 Score = 27.5 bits (58), Expect = 7.2 Identities = 13/32 (40%), Positives = 20/32 (62%) Frame = +1 Query: 271 LNRQKDIVDGKYSQLTSSNLDSKLREDLERLK 366 L R+K + + KY + +N D K RE++E LK Sbjct: 873 LRREKKVFE-KYQKAARANPDKKEREEIESLK 903 >SB_30168| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 6863 Score = 27.5 bits (58), Expect = 7.2 Identities = 13/35 (37%), Positives = 23/35 (65%), Gaps = 1/35 (2%) Frame = +1 Query: 292 VDGKYSQLTSSNLD-SKLREDLERLKKIRAHRGMR 393 V+ KY + S + + + LRE+LE +KK+R G++ Sbjct: 2765 VENKYKEKASDSANVAVLREELEDIKKLRQDMGIQ 2799 >SB_3781| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 499 Score = 27.5 bits (58), Expect = 7.2 Identities = 13/23 (56%), Positives = 18/23 (78%), Gaps = 2/23 (8%) Frame = +1 Query: 310 QLTSS--NLDSKLREDLERLKKI 372 QLTS N+D K+RE LE++KK+ Sbjct: 72 QLTSEEDNVDPKIREGLEKIKKL 94 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,782,686 Number of Sequences: 59808 Number of extensions: 302254 Number of successful extensions: 872 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 825 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 872 length of database: 16,821,457 effective HSP length: 78 effective length of database: 12,156,433 effective search space used: 1191330434 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -