BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV31000 (505 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY745219-1|AAU93486.1| 104|Anopheles gambiae cytochrome P450 pr... 26 0.63 AJ535206-1|CAD59406.1| 1376|Anopheles gambiae SMC4 protein protein. 26 0.83 AF444781-1|AAL37902.1| 1459|Anopheles gambiae Toll6 protein. 24 3.4 >AY745219-1|AAU93486.1| 104|Anopheles gambiae cytochrome P450 protein. Length = 104 Score = 26.2 bits (55), Expect = 0.63 Identities = 14/31 (45%), Positives = 16/31 (51%) Frame = +3 Query: 243 ANPLAAVTAGFASRSILHRSGDLGPEPQSIS 335 A PL + S LHRSGD PEP+ S Sbjct: 50 AIPLKVGDKLYVSVWALHRSGDYYPEPERFS 80 >AJ535206-1|CAD59406.1| 1376|Anopheles gambiae SMC4 protein protein. Length = 1376 Score = 25.8 bits (54), Expect = 0.83 Identities = 11/32 (34%), Positives = 16/32 (50%) Frame = +2 Query: 65 ARIENVSEDERSTTIDVGHHQDVGENTPNQAE 160 A +EN EDE + ++ +V N NQ E Sbjct: 1323 ANVENQREDEVAANVENAKENEVAANVENQNE 1354 >AF444781-1|AAL37902.1| 1459|Anopheles gambiae Toll6 protein. Length = 1459 Score = 23.8 bits (49), Expect = 3.4 Identities = 9/22 (40%), Positives = 14/22 (63%) Frame = +2 Query: 128 DVGENTPNQAEQAGFRSCNEAH 193 D+GEN+ + E+ GFR N + Sbjct: 493 DLGENSISVIEEPGFRGMNNLY 514 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 478,485 Number of Sequences: 2352 Number of extensions: 9774 Number of successful extensions: 14 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 14 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 14 length of database: 563,979 effective HSP length: 60 effective length of database: 422,859 effective search space used: 45245913 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -