BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV31000 (505 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY395072-1|AAQ96728.1| 593|Apis mellifera GABA neurotransmitter... 26 0.19 AY395071-1|AAQ96727.1| 646|Apis mellifera GABA neurotransmitter... 26 0.19 AY661557-1|AAT74557.1| 411|Apis mellifera yellow-f-like protein... 23 2.4 AY739658-1|AAU85297.1| 664|Apis mellifera hyperpolarization-act... 21 5.5 AY280848-1|AAQ16312.1| 632|Apis mellifera hyperpolarization-act... 21 5.5 >AY395072-1|AAQ96728.1| 593|Apis mellifera GABA neurotransmitter transporter-1B protein. Length = 593 Score = 26.2 bits (55), Expect = 0.19 Identities = 9/20 (45%), Positives = 15/20 (75%) Frame = -1 Query: 421 CIRMFSFNIVFFLPVLVLIF 362 C+ +F+FNI+ F+PV L + Sbjct: 503 CVGVFTFNIIKFVPVKYLTY 522 >AY395071-1|AAQ96727.1| 646|Apis mellifera GABA neurotransmitter transporter-1B protein. Length = 646 Score = 26.2 bits (55), Expect = 0.19 Identities = 9/20 (45%), Positives = 15/20 (75%) Frame = -1 Query: 421 CIRMFSFNIVFFLPVLVLIF 362 C+ +F+FNI+ F+PV L + Sbjct: 556 CVGVFTFNIIKFVPVKYLTY 575 >AY661557-1|AAT74557.1| 411|Apis mellifera yellow-f-like protein protein. Length = 411 Score = 22.6 bits (46), Expect = 2.4 Identities = 12/40 (30%), Positives = 21/40 (52%) Frame = +3 Query: 27 SAIINAGYKVSYSHASKMSVKTNAPPQLMWDIIRTWEKTH 146 SA+ GYK+ Y HA + + +++ D T EK++ Sbjct: 245 SALQTDGYKILYFHAMSSIAEFSVSTEVLQD--HTLEKSN 282 >AY739658-1|AAU85297.1| 664|Apis mellifera hyperpolarization-activated ion channelvariant L protein. Length = 664 Score = 21.4 bits (43), Expect = 5.5 Identities = 8/17 (47%), Positives = 12/17 (70%) Frame = +3 Query: 288 ILHRSGDLGPEPQSISA 338 + HR DLG E ++I+A Sbjct: 583 VAHREEDLGSESKTINA 599 >AY280848-1|AAQ16312.1| 632|Apis mellifera hyperpolarization-activated ion channel protein. Length = 632 Score = 21.4 bits (43), Expect = 5.5 Identities = 8/17 (47%), Positives = 12/17 (70%) Frame = +3 Query: 288 ILHRSGDLGPEPQSISA 338 + HR DLG E ++I+A Sbjct: 551 VAHREEDLGSESKTINA 567 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 127,197 Number of Sequences: 438 Number of extensions: 2616 Number of successful extensions: 5 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 146,343 effective HSP length: 54 effective length of database: 122,691 effective search space used: 13864083 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -