BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV31000 (505 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g15810.1 68418.m01850 N2,N2-dimethylguanosine tRNA methyltran... 66 2e-11 At3g02320.1 68416.m00214 N2,N2-dimethylguanosine tRNA methyltran... 65 3e-11 At1g51890.1 68414.m05849 leucine-rich repeat protein kinase, put... 33 0.11 At5g25930.1 68418.m03081 leucine-rich repeat family protein / pr... 31 0.44 At4g17870.1 68417.m02664 expressed protein 28 3.1 At3g61850.2 68416.m06946 Dof zinc finger protein DAG1 / Dof affe... 28 4.1 At3g61850.1 68416.m06945 Dof zinc finger protein DAG1 / Dof affe... 28 4.1 At4g31430.2 68417.m04465 expressed protein 27 5.4 At4g31430.1 68417.m04464 expressed protein 27 5.4 At1g75210.1 68414.m08737 5' nucleotidase family protein contains... 27 5.4 At1g55610.1 68414.m06365 protein kinase family protein contains ... 27 5.4 At5g13710.1 68418.m01596 sterol 24-C-methyltransferase, putative... 27 9.5 >At5g15810.1 68418.m01850 N2,N2-dimethylguanosine tRNA methyltransferase family protein similar to SP|Q9P804 N(2),N(2)-dimethylguanosine tRNA methyltransferase (EC 2.1.1.32) (tRNA(guanine-26,N(2)-N(2)) methyltransferase) {Schizosaccharomyces pombe}; contains Pfam profile PF02005: N2,N2-dimethylguanosine tRNA methyltransferase Length = 691 Score = 65.7 bits (153), Expect = 2e-11 Identities = 35/88 (39%), Positives = 51/88 (57%), Gaps = 2/88 (2%) Frame = +3 Query: 18 IMRSAIINAGYKVSYSHASKMSVKTNAPPQLMWDIIRTWEKTHPIKQSKLVSDPVTKHIL 197 + RSA+INA Y+VS SH + + +KT+AP +++WDI+R W K HPIK + IL Sbjct: 528 LFRSAVINAKYRVSGSHVNPLGIKTDAPMEIIWDIMRCWVKNHPIKPQS--PEHPGSVIL 585 Query: 198 SQDIKNNVDLS--VNELANPLAAVTAGF 275 S++ + D S V L+ A A F Sbjct: 586 SKEPSHQADFSRHVGSLSKAQAKKVARF 613 >At3g02320.1 68416.m00214 N2,N2-dimethylguanosine tRNA methyltransferase family protein similar to N2,N2-dimethylguanosine tRNA methyltransferase [Homo sapiens] GI:11066198; contains Pfam profile PF02005: N2,N2-dimethylguanosine tRNA methyltransferase Length = 599 Score = 64.9 bits (151), Expect = 3e-11 Identities = 33/88 (37%), Positives = 52/88 (59%), Gaps = 2/88 (2%) Frame = +3 Query: 18 IMRSAIINAGYKVSYSHASKMSVKTNAPPQLMWDIIRTWEKTHPIKQSKLVSDPVTKHIL 197 + RSA+INA Y++S +H + + +KT+AP +++WDI+R W K HPIK + IL Sbjct: 440 MFRSAVINANYRISGTHVNPLGMKTDAPMEVIWDIMRCWVKNHPIKAQS--PEQPGSVIL 497 Query: 198 SQDIKNNVDLS--VNELANPLAAVTAGF 275 S++ + VD S + L+ A A F Sbjct: 498 SKEPSHEVDFSRHIGSLSKAQAKKVARF 525 >At1g51890.1 68414.m05849 leucine-rich repeat protein kinase, putative similar to light repressible receptor protein kinase [Arabidopsis thaliana] gi|1321686|emb|CAA66376; contains leucine rich repeat (LRR) domains, Pfam:PF00560; contains protein kinase domain, Pfam:PF00069 Length = 888 Score = 33.1 bits (72), Expect = 0.11 Identities = 29/126 (23%), Positives = 52/126 (41%), Gaps = 3/126 (2%) Frame = +3 Query: 27 SAIINAGYKVSYSHASKMSVKTNAPPQLMWDIIRTWEKTHPIKQSKLVSDPVTKHILSQD 206 SA++N S S AP W+++ + S L S +T I Sbjct: 364 SAMMNIKTIYGLSKRSSWQGDPCAPELYRWEVLTFGLSIRNLSGSNL-SGTITSDISKLT 422 Query: 207 IKNNVDLSVNELANPLAAVTAGFASRSILHRSGDLG---PEPQSISATTKCRSLLKIRTR 377 +DLS N+L+ + V + + ++++ SG+ P+++ +SL IR Sbjct: 423 HLRELDLSNNDLSGDIPFVFSDMKNLTLINLSGNKNLNRSVPETLQKRIDNKSLTLIRDE 482 Query: 378 TGRKKT 395 TG+ T Sbjct: 483 TGKNST 488 >At5g25930.1 68418.m03081 leucine-rich repeat family protein / protein kinase family protein contains similarity to Swiss-Prot:P47735 receptor-like protein kinase 5 precursor [Arabidopsis thaliana]; contains Pfam domains PF00560: Leucine Rich Repeat and PF00069: Protein kinase domain Length = 1005 Score = 31.1 bits (67), Expect = 0.44 Identities = 25/80 (31%), Positives = 35/80 (43%), Gaps = 2/80 (2%) Frame = +3 Query: 216 NVDLSVNELANPLAAVTAGFASRS--ILHRSGDLGPEPQSISATTKCRSLLKIRTRTGRK 389 +VDLSVN L + V G + + L +G G P+SISAT L TG Sbjct: 239 HVDLSVNNLTGRIPDVLFGLKNLTEFYLFANGLTGEIPKSISATNLVFLDLSANNLTGSI 298 Query: 390 KTMLKENIRIQVTMIHGKKL 449 + ++QV + KL Sbjct: 299 PVSIGNLTKLQVLNLFNNKL 318 >At4g17870.1 68417.m02664 expressed protein Length = 191 Score = 28.3 bits (60), Expect = 3.1 Identities = 11/31 (35%), Positives = 20/31 (64%) Frame = +3 Query: 63 SHASKMSVKTNAPPQLMWDIIRTWEKTHPIK 155 S +S + + +APP+L+W I+R ++K K Sbjct: 29 SCSSLHAQRIHAPPELVWSIVRRFDKPQTYK 59 >At3g61850.2 68416.m06946 Dof zinc finger protein DAG1 / Dof affecting germination 1 (DAG1) / transcription factor BBFa (BBFA) identical to SP|Q43385 DOF zinc finger protein DAG1 (Dof affecting germination 1) (Transcription factor BBFa) (AtBBFa) (rolB domain B factor a) {Arabidopsis thaliana} Length = 284 Score = 27.9 bits (59), Expect = 4.1 Identities = 10/38 (26%), Positives = 20/38 (52%) Frame = +2 Query: 53 SILFARIENVSEDERSTTIDVGHHQDVGENTPNQAEQA 166 S+ F + + + + + + HHQ +G NT N ++A Sbjct: 197 SLGFPTMPDYKQSNNNLSFSIDHHQGIGHNTINSNQRA 234 >At3g61850.1 68416.m06945 Dof zinc finger protein DAG1 / Dof affecting germination 1 (DAG1) / transcription factor BBFa (BBFA) identical to SP|Q43385 DOF zinc finger protein DAG1 (Dof affecting germination 1) (Transcription factor BBFa) (AtBBFa) (rolB domain B factor a) {Arabidopsis thaliana} Length = 296 Score = 27.9 bits (59), Expect = 4.1 Identities = 10/38 (26%), Positives = 20/38 (52%) Frame = +2 Query: 53 SILFARIENVSEDERSTTIDVGHHQDVGENTPNQAEQA 166 S+ F + + + + + + HHQ +G NT N ++A Sbjct: 209 SLGFPTMPDYKQSNNNLSFSIDHHQGIGHNTINSNQRA 246 >At4g31430.2 68417.m04465 expressed protein Length = 574 Score = 27.5 bits (58), Expect = 5.4 Identities = 10/41 (24%), Positives = 26/41 (63%) Frame = +2 Query: 41 RWL*SILFARIENVSEDERSTTIDVGHHQDVGENTPNQAEQ 163 +++ S++F+ + SE++ ++ D+ +DV +N P+ E+ Sbjct: 68 KFISSVVFSDSSSSSEEDEDSSSDIDGDEDVEKNNPDFTEE 108 >At4g31430.1 68417.m04464 expressed protein Length = 485 Score = 27.5 bits (58), Expect = 5.4 Identities = 10/41 (24%), Positives = 26/41 (63%) Frame = +2 Query: 41 RWL*SILFARIENVSEDERSTTIDVGHHQDVGENTPNQAEQ 163 +++ S++F+ + SE++ ++ D+ +DV +N P+ E+ Sbjct: 68 KFISSVVFSDSSSSSEEDEDSSSDIDGDEDVEKNNPDFTEE 108 >At1g75210.1 68414.m08737 5' nucleotidase family protein contains Pfam profile: PF05761 5' nucleotidase family Length = 642 Score = 27.5 bits (58), Expect = 5.4 Identities = 21/81 (25%), Positives = 33/81 (40%), Gaps = 1/81 (1%) Frame = +3 Query: 174 DPVTKHILSQDIKNNVDLSVNELANPLAAVTAGFASRSILHRSGDLGPEP-QSISATTKC 350 D T L + + LS +L+ PL+ + F+ RS H P P + TT Sbjct: 36 DSYTPQCLFNSLTTTMRLSKRQLSLPLSLCFSTFSPRSRFHHFPGKYPAPRREFLHTTGT 95 Query: 351 RSLLKIRTRTGRKKTMLKENI 413 L + +K + L EN+ Sbjct: 96 SQLCFKSSMEDQKPSALSENV 116 >At1g55610.1 68414.m06365 protein kinase family protein contains Prosite:PS00107: Protein kinases ATP-binding region signature Length = 1166 Score = 27.5 bits (58), Expect = 5.4 Identities = 14/32 (43%), Positives = 18/32 (56%), Gaps = 1/32 (3%) Frame = -1 Query: 325 CGSGPRSPERCRIDLEAKPAVTAA-SGLASSF 233 CGS PR P RI + + TA +G+A SF Sbjct: 755 CGSAPRRPITSRIHAKKQTVATAVIAGIAFSF 786 >At5g13710.1 68418.m01596 sterol 24-C-methyltransferase, putative similar to SP:P25087 Sterol 24-C-methyltransferase, Delta(24)-sterol C- methyltransferase, Saccharomyces cerevisiae Length = 336 Score = 26.6 bits (56), Expect = 9.5 Identities = 14/42 (33%), Positives = 20/42 (47%) Frame = -2 Query: 333 ILTAALDPGPQNGAGLIWKRSLPSRRPVDWLAHSPTNRHYSL 208 + T L+ Q G +IW++ L PV W N H+SL Sbjct: 231 LTTKCLEALKQAGFEVIWEKDLAKDSPVPWYLPLDKN-HFSL 271 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 9,916,920 Number of Sequences: 28952 Number of extensions: 190948 Number of successful extensions: 623 Number of sequences better than 10.0: 12 Number of HSP's better than 10.0 without gapping: 603 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 623 length of database: 12,070,560 effective HSP length: 76 effective length of database: 9,870,208 effective search space used: 898188928 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -