BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30999x (484 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AB090815-2|BAC57906.1| 973|Anopheles gambiae reverse transcript... 24 3.1 AJ000675-1|CAA04232.1| 600|Anopheles gambiae infection responsi... 23 4.2 AB090814-2|BAC57904.1| 1049|Anopheles gambiae reverse transcript... 22 9.6 >AB090815-2|BAC57906.1| 973|Anopheles gambiae reverse transcriptase protein. Length = 973 Score = 23.8 bits (49), Expect = 3.1 Identities = 10/30 (33%), Positives = 15/30 (50%) Frame = -1 Query: 364 STDSAPMSIKGRHIEQVGSFCYLGSIVDDR 275 + S + + IE + YLG I+DDR Sbjct: 686 TVQSGSIRVGDERIESIRHLKYLGVIIDDR 715 >AJ000675-1|CAA04232.1| 600|Anopheles gambiae infection responsive serine proteaselike protein protein. Length = 600 Score = 23.4 bits (48), Expect = 4.2 Identities = 9/17 (52%), Positives = 10/17 (58%) Frame = +1 Query: 265 RCLPYRPQCCPSNRSFP 315 RC Y CCP N +FP Sbjct: 110 RCPAYEEVCCPKN-AFP 125 >AB090814-2|BAC57904.1| 1049|Anopheles gambiae reverse transcriptase protein. Length = 1049 Score = 22.2 bits (45), Expect = 9.6 Identities = 8/17 (47%), Positives = 11/17 (64%) Frame = -1 Query: 325 IEQVGSFCYLGSIVDDR 275 +E S YLG ++DDR Sbjct: 760 VESTRSLKYLGVVIDDR 776 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 515,934 Number of Sequences: 2352 Number of extensions: 11038 Number of successful extensions: 17 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 16 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 17 length of database: 563,979 effective HSP length: 60 effective length of database: 422,859 effective search space used: 42285900 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -