BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30998 (449 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value EF540769-1|ABQ14707.1| 620|Apis mellifera adenosine deaminase p... 22 3.6 DQ667184-1|ABG75736.1| 489|Apis mellifera GABA-gated ion channe... 22 3.6 DQ325094-1|ABD14108.1| 175|Apis mellifera complementary sex det... 21 6.2 DQ325093-1|ABD14107.1| 175|Apis mellifera complementary sex det... 21 6.2 DQ325092-1|ABD14106.1| 175|Apis mellifera complementary sex det... 21 6.2 DQ325091-1|ABD14105.1| 175|Apis mellifera complementary sex det... 21 6.2 AY569716-1|AAS86669.1| 406|Apis mellifera complementary sex det... 21 6.2 AY569710-1|AAS86663.1| 408|Apis mellifera complementary sex det... 21 6.2 AY569709-1|AAS86662.1| 408|Apis mellifera complementary sex det... 21 6.2 AY569708-1|AAS86661.1| 408|Apis mellifera complementary sex det... 21 6.2 AY569707-1|AAS86660.1| 408|Apis mellifera complementary sex det... 21 6.2 AY569706-1|AAS86659.1| 397|Apis mellifera complementary sex det... 21 6.2 AY313893-1|AAQ82184.1| 437|Apis mellifera major royal jelly pro... 21 6.2 >EF540769-1|ABQ14707.1| 620|Apis mellifera adenosine deaminase protein. Length = 620 Score = 21.8 bits (44), Expect = 3.6 Identities = 8/20 (40%), Positives = 11/20 (55%) Frame = +2 Query: 212 HEERASCSHHSNRPVRKEIK 271 HEE S H NR R +++ Sbjct: 381 HEENESVDKHPNRRARGQLR 400 >DQ667184-1|ABG75736.1| 489|Apis mellifera GABA-gated ion channel protein. Length = 489 Score = 21.8 bits (44), Expect = 3.6 Identities = 10/35 (28%), Positives = 17/35 (48%) Frame = -1 Query: 233 NSSLVLRGSRSPGSDYGQHAVRGQPRFNSVRIAVF 129 N S ++ GS +PG+ + P F R+A + Sbjct: 385 NRSGLVSGSSTPGTGREHDPAKFPPSFRISRVAAY 419 >DQ325094-1|ABD14108.1| 175|Apis mellifera complementary sex determiner protein. Length = 175 Score = 21.0 bits (42), Expect = 6.2 Identities = 9/31 (29%), Positives = 16/31 (51%) Frame = +2 Query: 173 RRADRNRSQDSGCHEERASCSHHSNRPVRKE 265 RR ++ ++ EER SC +S R++ Sbjct: 17 RRYEKLHNEKEKLLEERTSCKRYSRSREREQ 47 >DQ325093-1|ABD14107.1| 175|Apis mellifera complementary sex determiner protein. Length = 175 Score = 21.0 bits (42), Expect = 6.2 Identities = 9/31 (29%), Positives = 16/31 (51%) Frame = +2 Query: 173 RRADRNRSQDSGCHEERASCSHHSNRPVRKE 265 RR ++ ++ EER SC +S R++ Sbjct: 17 RRYEKLHNEKEKLLEERTSCKRYSRSREREQ 47 >DQ325092-1|ABD14106.1| 175|Apis mellifera complementary sex determiner protein. Length = 175 Score = 21.0 bits (42), Expect = 6.2 Identities = 9/31 (29%), Positives = 16/31 (51%) Frame = +2 Query: 173 RRADRNRSQDSGCHEERASCSHHSNRPVRKE 265 RR ++ ++ EER SC +S R++ Sbjct: 17 RRYEKLHNEKEKLLEERTSCKRYSRSREREQ 47 >DQ325091-1|ABD14105.1| 175|Apis mellifera complementary sex determiner protein. Length = 175 Score = 21.0 bits (42), Expect = 6.2 Identities = 9/31 (29%), Positives = 16/31 (51%) Frame = +2 Query: 173 RRADRNRSQDSGCHEERASCSHHSNRPVRKE 265 RR ++ ++ EER SC +S R++ Sbjct: 17 RRYEKLHNEKEKLLEERTSCKRYSRSREREQ 47 >AY569716-1|AAS86669.1| 406|Apis mellifera complementary sex determiner protein. Length = 406 Score = 21.0 bits (42), Expect = 6.2 Identities = 9/31 (29%), Positives = 16/31 (51%) Frame = +2 Query: 173 RRADRNRSQDSGCHEERASCSHHSNRPVRKE 265 RR ++ ++ EER SC +S R++ Sbjct: 250 RRYEKLHNEKEKLLEERTSCKRYSRSREREQ 280 >AY569710-1|AAS86663.1| 408|Apis mellifera complementary sex determiner protein. Length = 408 Score = 21.0 bits (42), Expect = 6.2 Identities = 9/31 (29%), Positives = 16/31 (51%) Frame = +2 Query: 173 RRADRNRSQDSGCHEERASCSHHSNRPVRKE 265 RR ++ ++ EER SC +S R++ Sbjct: 250 RRYEKLHNEKEKLLEERTSCKRYSRSREREQ 280 >AY569709-1|AAS86662.1| 408|Apis mellifera complementary sex determiner protein. Length = 408 Score = 21.0 bits (42), Expect = 6.2 Identities = 9/31 (29%), Positives = 16/31 (51%) Frame = +2 Query: 173 RRADRNRSQDSGCHEERASCSHHSNRPVRKE 265 RR ++ ++ EER SC +S R++ Sbjct: 250 RRYEKLHNEKEKLLEERTSCKRYSRSREREQ 280 >AY569708-1|AAS86661.1| 408|Apis mellifera complementary sex determiner protein. Length = 408 Score = 21.0 bits (42), Expect = 6.2 Identities = 9/31 (29%), Positives = 16/31 (51%) Frame = +2 Query: 173 RRADRNRSQDSGCHEERASCSHHSNRPVRKE 265 RR ++ ++ EER SC +S R++ Sbjct: 250 RRYEKLHNEKEKLLEERTSCKRYSRSREREQ 280 >AY569707-1|AAS86660.1| 408|Apis mellifera complementary sex determiner protein. Length = 408 Score = 21.0 bits (42), Expect = 6.2 Identities = 9/31 (29%), Positives = 16/31 (51%) Frame = +2 Query: 173 RRADRNRSQDSGCHEERASCSHHSNRPVRKE 265 RR ++ ++ EER SC +S R++ Sbjct: 250 RRYEKLHNEKEKLLEERTSCKRYSRSREREQ 280 >AY569706-1|AAS86659.1| 397|Apis mellifera complementary sex determiner protein. Length = 397 Score = 21.0 bits (42), Expect = 6.2 Identities = 9/31 (29%), Positives = 16/31 (51%) Frame = +2 Query: 173 RRADRNRSQDSGCHEERASCSHHSNRPVRKE 265 RR ++ ++ EER SC +S R++ Sbjct: 239 RRYEKLHNEKEKLLEERTSCKRYSRSREREQ 269 >AY313893-1|AAQ82184.1| 437|Apis mellifera major royal jelly protein MRJP6 protein. Length = 437 Score = 21.0 bits (42), Expect = 6.2 Identities = 8/31 (25%), Positives = 15/31 (48%) Frame = -1 Query: 413 NINTIKRSVSQARTRNANKINTRYTFLIHSD 321 N+N + ++ A++ N N +Y H D Sbjct: 407 NVNNLIKNTRCAKSNNQNNNQNKYKNQAHLD 437 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 93,391 Number of Sequences: 438 Number of extensions: 1743 Number of successful extensions: 14 Number of sequences better than 10.0: 13 Number of HSP's better than 10.0 without gapping: 14 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 14 length of database: 146,343 effective HSP length: 53 effective length of database: 123,129 effective search space used: 11820384 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.2 bits)
- SilkBase 1999-2023 -