BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30995 (506 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U39852-7|AAK39260.1| 240|Caenorhabditis elegans Ground-like (gr... 30 0.84 U58735-1|AAC48148.1| 891|Caenorhabditis elegans Hypothetical pr... 30 1.1 AF054983-1|AAC72298.1| 1066|Caenorhabditis elegans reverse trans... 30 1.1 AF025462-7|AAB71003.1| 805|Caenorhabditis elegans Hypothetical ... 30 1.1 AC087794-3|AAG53700.1| 417|Caenorhabditis elegans Hypothetical ... 30 1.1 Z29094-8|CAA82337.1| 254|Caenorhabditis elegans Hypothetical pr... 29 1.9 U41557-6|AAA83307.1| 589|Caenorhabditis elegans Collagen sequen... 29 2.6 Z78415-10|CAB01676.2| 341|Caenorhabditis elegans Hypothetical p... 28 3.4 AC103567-9|AAL35735.1| 204|Caenorhabditis elegans Hypothetical ... 28 3.4 >U39852-7|AAK39260.1| 240|Caenorhabditis elegans Ground-like (grd related) protein 6 protein. Length = 240 Score = 30.3 bits (65), Expect = 0.84 Identities = 17/48 (35%), Positives = 19/48 (39%) Frame = +2 Query: 197 LPTAGHRPSPMPST*CGPPLPHPTTSRRAH*VVSPPGWRTPHAPCTHP 340 +P A P PMP C PP P P + PP P PC P Sbjct: 39 MPCAAPMPMPMPMPVCPPPPPCPAQFCPPPPICPPP--PPPPMPCPPP 84 >U58735-1|AAC48148.1| 891|Caenorhabditis elegans Hypothetical protein F20B4.7 protein. Length = 891 Score = 29.9 bits (64), Expect = 1.1 Identities = 12/21 (57%), Positives = 14/21 (66%) Frame = -2 Query: 328 RSVGRPPTRWTDDLVRTAGSR 266 R VGRPP RWTD L + +R Sbjct: 840 RPVGRPPMRWTDSLRKEITTR 860 >AF054983-1|AAC72298.1| 1066|Caenorhabditis elegans reverse transcriptase protein. Length = 1066 Score = 29.9 bits (64), Expect = 1.1 Identities = 12/21 (57%), Positives = 14/21 (66%) Frame = -2 Query: 328 RSVGRPPTRWTDDLVRTAGSR 266 R VGRPP RWTD L + +R Sbjct: 1015 RPVGRPPMRWTDSLRKEITTR 1035 >AF025462-7|AAB71003.1| 805|Caenorhabditis elegans Hypothetical protein K10F12.5 protein. Length = 805 Score = 29.9 bits (64), Expect = 1.1 Identities = 12/21 (57%), Positives = 14/21 (66%) Frame = -2 Query: 328 RSVGRPPTRWTDDLVRTAGSR 266 R VGRPP RWTD L + +R Sbjct: 754 RPVGRPPMRWTDSLRKEITTR 774 >AC087794-3|AAG53700.1| 417|Caenorhabditis elegans Hypothetical protein Y32G9A.9 protein. Length = 417 Score = 29.9 bits (64), Expect = 1.1 Identities = 12/21 (57%), Positives = 14/21 (66%) Frame = -2 Query: 328 RSVGRPPTRWTDDLVRTAGSR 266 R VGRPP RWTD L + +R Sbjct: 366 RPVGRPPMRWTDSLRKEITTR 386 >Z29094-8|CAA82337.1| 254|Caenorhabditis elegans Hypothetical protein C07A9.10 protein. Length = 254 Score = 29.1 bits (62), Expect = 1.9 Identities = 12/23 (52%), Positives = 15/23 (65%) Frame = -2 Query: 328 RSVGRPPTRWTDDLVRTAGSRWM 260 R VG+PP RWTD L + +R M Sbjct: 15 RPVGKPPMRWTDSLRKEITTRDM 37 >U41557-6|AAA83307.1| 589|Caenorhabditis elegans Collagen sequence x-hybridizingprotein 1 protein. Length = 589 Score = 28.7 bits (61), Expect = 2.6 Identities = 19/49 (38%), Positives = 21/49 (42%), Gaps = 1/49 (2%) Frame = +2 Query: 197 LPTAGHRPSPMPST*CGPP-LPHPTTSRRAH*VVSPPGWRTPHAPCTHP 340 LP P P P GPP PHP SRR P R+PH+ P Sbjct: 79 LPGPSGAP-PGPPHPSGPPHRPHPHPSRRPRPTRLPRPSRSPHSDAPEP 126 >Z78415-10|CAB01676.2| 341|Caenorhabditis elegans Hypothetical protein C17G1.7 protein. Length = 341 Score = 28.3 bits (60), Expect = 3.4 Identities = 10/16 (62%), Positives = 12/16 (75%) Frame = -3 Query: 249 GPHYVEGIGEGLCPAV 202 GPH ++GIG G PAV Sbjct: 221 GPHKIQGIGAGFAPAV 236 >AC103567-9|AAL35735.1| 204|Caenorhabditis elegans Hypothetical protein Y51F10.8 protein. Length = 204 Score = 28.3 bits (60), Expect = 3.4 Identities = 11/21 (52%), Positives = 13/21 (61%) Frame = -2 Query: 328 RSVGRPPTRWTDDLVRTAGSR 266 R VGRPP RW D L + +R Sbjct: 151 RPVGRPPMRWNDSLRKEVTTR 171 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 9,097,295 Number of Sequences: 27780 Number of extensions: 165422 Number of successful extensions: 418 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 410 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 417 length of database: 12,740,198 effective HSP length: 76 effective length of database: 10,628,918 effective search space used: 977860456 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -