BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30988 (794 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY769607-1|AAV40983.1| 196|Tribolium castaneum heat shock cogna... 141 7e-36 AY769606-1|AAV40982.1| 196|Tribolium castaneum heat shock prote... 141 7e-36 AY769608-1|AAV40984.1| 195|Tribolium castaneum heat shock prote... 124 6e-31 EF633444-1|ABR32189.1| 721|Tribolium castaneum heat shock prote... 23 2.8 EF222292-1|ABN79652.1| 354|Tribolium castaneum cardioactive pep... 23 3.7 AJ621748-1|CAF21851.1| 228|Tribolium castaneum zinc finger tran... 23 3.7 DQ659253-1|ABG47451.1| 439|Tribolium castaneum imaginal disc gr... 22 4.9 DQ372925-1|ABD17350.1| 596|Tribolium castaneum telomerase rever... 21 8.6 >AY769607-1|AAV40983.1| 196|Tribolium castaneum heat shock cognate 70 protein. Length = 196 Score = 141 bits (341), Expect = 7e-36 Identities = 65/84 (77%), Positives = 75/84 (89%) Frame = +3 Query: 510 AAAIAYGLDKKGTGERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRM 689 AAAIAYGLDKK ERNVLIFDLGGGTFDVS+LTIE+GIFEVK+TAGDTHLGGEDFDNR+ Sbjct: 6 AAAIAYGLDKKAEKERNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFDNRL 65 Query: 690 VNHFVQEFKRKYKKDLATNKRALR 761 V + Q+FK+K+K D++ N RALR Sbjct: 66 VEYCTQDFKKKHKADISGNPRALR 89 >AY769606-1|AAV40982.1| 196|Tribolium castaneum heat shock protein 70 protein. Length = 196 Score = 141 bits (341), Expect = 7e-36 Identities = 65/84 (77%), Positives = 75/84 (89%) Frame = +3 Query: 510 AAAIAYGLDKKGTGERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRM 689 AAAIAYGLDKK ERNVLIFDLGGGTFDVS+LTIE+GIFEVK+TAGDTHLGGEDFDNR+ Sbjct: 6 AAAIAYGLDKKAERERNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFDNRL 65 Query: 690 VNHFVQEFKRKYKKDLATNKRALR 761 V + Q+FK+K+K D++ N RALR Sbjct: 66 VEYCTQDFKKKHKADISGNPRALR 89 >AY769608-1|AAV40984.1| 195|Tribolium castaneum heat shock protein 70 protein. Length = 195 Score = 124 bits (300), Expect = 6e-31 Identities = 54/84 (64%), Positives = 76/84 (90%) Frame = +3 Query: 510 AAAIAYGLDKKGTGERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRM 689 AAAIAYGLDKKG E+N+L++DLGGGTFDVSILTI++G+FEV +T+GDTHLGGEDFD ++ Sbjct: 6 AAAIAYGLDKKGA-EQNILVYDLGGGTFDVSILTIDNGVFEVVATSGDTHLGGEDFDQKV 64 Query: 690 VNHFVQEFKRKYKKDLATNKRALR 761 +++F++ K+K+KKD+ +K+AL+ Sbjct: 65 MDYFIKMVKQKHKKDIRADKKALQ 88 >EF633444-1|ABR32189.1| 721|Tribolium castaneum heat shock protein 90 protein. Length = 721 Score = 23.0 bits (47), Expect = 2.8 Identities = 14/42 (33%), Positives = 19/42 (45%) Frame = +1 Query: 268 DGGKPKIKVAYKGEDKTFFPEEVSSMVLTKMKETAEAYLGKT 393 D KPKI+ + ED+ E+ K K T + L KT Sbjct: 241 DKDKPKIEDVGEDEDEDTKKEDKKKKKTIKEKYTEDEELNKT 282 >EF222292-1|ABN79652.1| 354|Tribolium castaneum cardioactive peptide receptor 2 protein. Length = 354 Score = 22.6 bits (46), Expect = 3.7 Identities = 8/18 (44%), Positives = 11/18 (61%) Frame = +1 Query: 40 LPAREGGDHRQRPGQQDH 93 +P R+ DHR RP + H Sbjct: 246 IPIRQCDDHRDRPPRHFH 263 >AJ621748-1|CAF21851.1| 228|Tribolium castaneum zinc finger transcription factor protein. Length = 228 Score = 22.6 bits (46), Expect = 3.7 Identities = 17/49 (34%), Positives = 27/49 (55%), Gaps = 7/49 (14%) Frame = +3 Query: 339 FH-GAYENEGNCRSL---SWQNCA---ECSYHGSRVLQ*LSKTSHKRCR 464 FH GA+ EG C+S ++ N + EC +G V+ ++T+ K CR Sbjct: 15 FHFGAFTCEG-CKSFFGRTYNNISSISECKNNGECVINKKNRTACKACR 62 >DQ659253-1|ABG47451.1| 439|Tribolium castaneum imaginal disc growth factor 2 protein. Length = 439 Score = 22.2 bits (45), Expect = 4.9 Identities = 8/19 (42%), Positives = 13/19 (68%) Frame = +1 Query: 451 TKDAGTISGLNVLRIINEP 507 TKDAG +S + ++N+P Sbjct: 330 TKDAGLLSYPEICTLLNDP 348 >DQ372925-1|ABD17350.1| 596|Tribolium castaneum telomerase reverse transcriptase protein. Length = 596 Score = 21.4 bits (43), Expect = 8.6 Identities = 11/61 (18%), Positives = 24/61 (39%) Frame = -1 Query: 701 KVVDHAIVKVLTSQVGVAGGGFHLEDTILDGKDGHVEGTAAEVKDKYISFSSTLFVKTVS 522 K++ I KVL + +G + G + G +++D Y + + K + Sbjct: 210 KLLTSKIYKVLEEKYKTSGSLYTCWSEFTQKTQGQIYGIKVDIRDAYGNVKIPVLCKLIQ 269 Query: 521 N 519 + Sbjct: 270 S 270 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 200,339 Number of Sequences: 336 Number of extensions: 4617 Number of successful extensions: 16 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 14 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 15 length of database: 122,585 effective HSP length: 56 effective length of database: 103,769 effective search space used: 21583952 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -