BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30987 (793 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC19C7.11 |||ClC chloride channel |Schizosaccharomyces pombe|c... 26 7.1 SPCC584.01c |||sulfite reductase NADPH flavoprotein subunit |Sch... 25 9.4 >SPBC19C7.11 |||ClC chloride channel |Schizosaccharomyces pombe|chr 2|||Manual Length = 812 Score = 25.8 bits (54), Expect = 7.1 Identities = 13/35 (37%), Positives = 19/35 (54%) Frame = -2 Query: 276 YHIFLSDYDYYLI*YRLKSLLNLTFKSVKITLNFT 172 Y + L YLI Y KS L +F++ K+ +FT Sbjct: 655 YPVVLDSRSNYLIGYLKKSSLKSSFEAAKLEPSFT 689 >SPCC584.01c |||sulfite reductase NADPH flavoprotein subunit |Schizosaccharomyces pombe|chr 3|||Manual Length = 1006 Score = 25.4 bits (53), Expect = 9.4 Identities = 9/20 (45%), Positives = 14/20 (70%) Frame = -1 Query: 649 AINIKIKSFSYHNEFSIFSS 590 A N+ + FSY N F++F+S Sbjct: 134 ADNVSVLDFSYANNFTVFAS 153 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,741,561 Number of Sequences: 5004 Number of extensions: 49360 Number of successful extensions: 104 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 101 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 104 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 385381248 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -