BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30987 (793 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 02_01_0478 - 3442222-3442227,3442777-3442848,3442966-3443137,344... 29 4.2 >02_01_0478 - 3442222-3442227,3442777-3442848,3442966-3443137, 3443388-3443500,3443771-3443908,3444016-3444221, 3444317-3444388,3444484-3444532,3444635-3444714, 3444817-3445132,3445242-3445415,3445513-3446139, 3446235-3446297,3446399-3446470,3446602-3446664, 3446741-3446872,3447779-3447889,3449273-3449371, 3450117-3450194 Length = 880 Score = 29.1 bits (62), Expect = 4.2 Identities = 16/41 (39%), Positives = 24/41 (58%) Frame = -1 Query: 700 VRHNNKHFMPVVTKRKEAINIKIKSFSYHNEFSIFSS*RIP 578 +R + K+F VV+K E I IK+F +H+ +F S IP Sbjct: 221 IRFSAKYFAEVVSKLPEEKKIVIKNFGFHS-LLLFDSSFIP 260 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,879,161 Number of Sequences: 37544 Number of extensions: 234128 Number of successful extensions: 348 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 347 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 348 length of database: 14,793,348 effective HSP length: 81 effective length of database: 11,752,284 effective search space used: 2138915688 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -