BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30980 (792 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB253416-1|BAE86927.1| 580|Apis mellifera alpha-glucosidase pro... 23 2.5 DQ011227-1|AAY63896.1| 484|Apis mellifera Amt-1-like protein pr... 23 3.3 DQ288391-1|ABC41341.1| 630|Apis mellifera vasa protein protein. 22 5.7 AB204558-1|BAD89803.1| 1143|Apis mellifera nitric oxide synthase... 22 7.5 AY703685-1|AAU12681.1| 200|Apis mellifera abdominal-A protein. 21 9.9 >AB253416-1|BAE86927.1| 580|Apis mellifera alpha-glucosidase protein. Length = 580 Score = 23.4 bits (48), Expect = 2.5 Identities = 10/25 (40%), Positives = 12/25 (48%) Frame = +1 Query: 394 DHPWFLSPVFRTRSRGSRYESSDAR 468 +HPWF V R + Y DAR Sbjct: 128 EHPWFKKSVQRIKPYDEYYVWRDAR 152 >DQ011227-1|AAY63896.1| 484|Apis mellifera Amt-1-like protein protein. Length = 484 Score = 23.0 bits (47), Expect = 3.3 Identities = 14/42 (33%), Positives = 22/42 (52%) Frame = +2 Query: 335 EQLTILRRIETASGNLYKEKIIRGFCHLYSGQEAVAVGMRAA 460 +++ IL +I G+L I G C L+ E++ VGM A Sbjct: 281 DRIDILSQINGILGSLVA---ITGGCFLFRAWESIIVGMIGA 319 >DQ288391-1|ABC41341.1| 630|Apis mellifera vasa protein protein. Length = 630 Score = 22.2 bits (45), Expect = 5.7 Identities = 10/16 (62%), Positives = 10/16 (62%) Frame = +1 Query: 547 ELTGRRTGCSRGKGGS 594 E TGR G GKGGS Sbjct: 76 EETGRGKGRGHGKGGS 91 >AB204558-1|BAD89803.1| 1143|Apis mellifera nitric oxide synthase protein. Length = 1143 Score = 21.8 bits (44), Expect = 7.5 Identities = 11/37 (29%), Positives = 17/37 (45%) Frame = +2 Query: 320 ALKLYEQLTILRRIETASGNLYKEKIIRGFCHLYSGQ 430 AL + T+L ET + +Y EK+ H + Q Sbjct: 463 ALSRRIKATVLFATETGTSQMYAEKLSELLGHAFHSQ 499 >AY703685-1|AAU12681.1| 200|Apis mellifera abdominal-A protein. Length = 200 Score = 21.4 bits (43), Expect = 9.9 Identities = 12/33 (36%), Positives = 15/33 (45%) Frame = +2 Query: 671 PSPTSTAPTGESRSLCTETEPPIRVNSSKPTHV 769 PSPT ++P S T P R SS +V Sbjct: 62 PSPTGSSPQHSGSS--ASTSPAARTTSSMYPYV 92 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 226,130 Number of Sequences: 438 Number of extensions: 5255 Number of successful extensions: 12 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 12 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 12 length of database: 146,343 effective HSP length: 57 effective length of database: 121,377 effective search space used: 25003662 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -