BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30980 (792 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g59900.1 68414.m06748 pyruvate dehydrogenase E1 component alp... 123 2e-28 At1g24180.1 68414.m03050 pyruvate dehydrogenase E1 component alp... 123 2e-28 At1g01090.1 68414.m00011 pyruvate dehydrogenase E1 component alp... 83 3e-16 At5g56330.1 68418.m07031 carbonic anhydrase family protein conta... 36 0.041 At4g16980.1 68417.m02560 arabinogalactan-protein family similar ... 35 0.054 At4g12470.1 68417.m01972 protease inhibitor/seed storage/lipid t... 32 0.50 At3g24550.1 68416.m03083 protein kinase family protein contains ... 31 0.66 At1g21400.1 68414.m02678 2-oxoisovalerate dehydrogenase, putativ... 31 0.66 At5g09300.2 68418.m01077 2-oxoisovalerate dehydrogenase, putativ... 30 1.5 At5g09300.1 68418.m01078 2-oxoisovalerate dehydrogenase, putativ... 30 1.5 At4g15560.1 68417.m02377 1-deoxy-D-xylulose 5-phosphate synthase... 30 1.5 At4g18670.1 68417.m02762 leucine-rich repeat family protein / ex... 30 2.0 At3g22120.1 68416.m02792 protease inhibitor/seed storage/lipid t... 30 2.0 At1g71980.1 68414.m08320 protease-associated zinc finger (C3HC4-... 30 2.0 At1g20130.1 68414.m02518 family II extracellular lipase, putativ... 30 2.0 At5g38560.1 68418.m04662 protein kinase family protein contains ... 29 2.7 At5g14920.1 68418.m01750 gibberellin-regulated family protein si... 29 2.7 At3g50580.1 68416.m05532 proline-rich family protein contains pr... 29 2.7 At1g79730.1 68414.m09300 hydroxyproline-rich glycoprotein family... 29 2.7 At5g60730.1 68418.m07620 anion-transporting ATPase family protei... 29 3.5 At4g22470.1 68417.m03245 protease inhibitor/seed storage/lipid t... 29 3.5 At1g62440.1 68414.m07044 leucine-rich repeat family protein / ex... 29 3.5 At5g10430.1 68418.m01209 arabinogalactan-protein (AGP4) identica... 29 4.7 At3g58510.2 68416.m06522 DEAD box RNA helicase, putative (RH11) ... 29 4.7 At3g58510.1 68416.m06521 DEAD box RNA helicase, putative (RH11) ... 29 4.7 At3g56410.2 68416.m06274 expressed protein 29 4.7 At3g56410.1 68416.m06273 expressed protein 29 4.7 At1g26150.1 68414.m03192 protein kinase family protein similar t... 29 4.7 At4g01985.1 68417.m00265 expressed protein 28 6.2 At2g43680.2 68415.m05430 calmodulin-binding family protein simil... 28 6.2 At2g43680.1 68415.m05429 calmodulin-binding family protein simil... 28 6.2 At2g39650.1 68415.m04862 expressed protein contains Pfam profile... 28 6.2 At1g53180.1 68414.m06027 expressed protein 28 6.2 At5g13660.1 68418.m01590 expressed protein 28 8.2 At3g58570.1 68416.m06528 DEAD box RNA helicase, putative similar... 28 8.2 At3g21500.2 68416.m02713 1-deoxy-D-xylulose 5-phosphate synthase... 28 8.2 At3g21500.1 68416.m02712 1-deoxy-D-xylulose 5-phosphate synthase... 28 8.2 At2g25737.1 68415.m03087 expressed protein contains Pfam profil... 28 8.2 At1g26110.1 68414.m03186 expressed protein 28 8.2 >At1g59900.1 68414.m06748 pyruvate dehydrogenase E1 component alpha subunit, mitochondrial (PDHE1-A) identical to SP|P52901 Pyruvate dehydrogenase E1 component alpha subunit, mitochondrial precursor (EC 1.2.4.1) (PDHE1-A) {Arabidopsis thaliana} Length = 389 Score = 123 bits (296), Expect = 2e-28 Identities = 62/95 (65%), Positives = 71/95 (74%), Gaps = 2/95 (2%) Frame = +1 Query: 481 DHRVSLSRMAYLMGVSVLGVLSELTGRRTGCSRGKGGSMHLYGR--NFYGGNGIVGAQVP 654 DH + L R G S+ V SEL GR+ GCS+GKGGSMH Y + +FYGG+GIVGAQVP Sbjct: 118 DHCIFLGR-----GGSLHEVFSELMGRQAGCSKGKGGSMHFYKKESSFYGGHGIVGAQVP 172 Query: 655 LGAGVAFAHKYRADGGVTFALYGDGAANQGQLFEA 759 LG G+AFA KY + VTFALYGDGAANQGQLFEA Sbjct: 173 LGCGIAFAQKYNKEEAVTFALYGDGAANQGQLFEA 207 Score = 89.8 bits (213), Expect = 2e-18 Identities = 40/82 (48%), Positives = 57/82 (69%) Frame = +2 Query: 257 PYKLHKLDQGPATSATLTSEDALKLYEQLTILRRIETASGNLYKEKIIRGFCHLYSGQEA 436 P+ H D P+ S +S++ L + + ++RR+E A+ +LYK K+IRGFCHLY GQEA Sbjct: 39 PFTAHLCDP-PSRSVESSSQELLDFFRTMALMRRMEIAADSLYKAKLIRGFCHLYDGQEA 97 Query: 437 VAVGMRAAMRDADSVITAYRCH 502 VA+GM AA+ D++ITAYR H Sbjct: 98 VAIGMEAAITKKDAIITAYRDH 119 >At1g24180.1 68414.m03050 pyruvate dehydrogenase E1 component alpha subunit, mitochondrial, putative similar to SP|P52901 Pyruvate dehydrogenase E1 component alpha subunit, mitochondrial precursor (EC 1.2.4.1) (PDHE1-A) {Arabidopsis thaliana}; contains Pfam profile PF00676: Dehydrogenase E1 component Length = 393 Score = 123 bits (296), Expect = 2e-28 Identities = 57/82 (69%), Positives = 65/82 (79%), Gaps = 2/82 (2%) Frame = +1 Query: 520 GVSVLGVLSELTGRRTGCSRGKGGSMHLYGRN--FYGGNGIVGAQVPLGAGVAFAHKYRA 693 G ++ SEL GR+TGCS GKGGSMH Y ++ FYGG+GIVGAQ+PLG G+AFA KY Sbjct: 130 GGKLVDAFSELMGRKTGCSHGKGGSMHFYKKDASFYGGHGIVGAQIPLGCGLAFAQKYNK 189 Query: 694 DGGVTFALYGDGAANQGQLFEA 759 D VTFALYGDGAANQGQLFEA Sbjct: 190 DEAVTFALYGDGAANQGQLFEA 211 Score = 87.8 bits (208), Expect = 7e-18 Identities = 40/82 (48%), Positives = 57/82 (69%) Frame = +2 Query: 257 PYKLHKLDQGPATSATLTSEDALKLYEQLTILRRIETASGNLYKEKIIRGFCHLYSGQEA 436 P+ H L + P+ S +SE+ L + + +RR+E A+ +LYK K+IRGFCHLY GQEA Sbjct: 43 PFTSH-LCESPSRSVETSSEEILAFFRDMARMRRMEIAADSLYKAKLIRGFCHLYDGQEA 101 Query: 437 VAVGMRAAMRDADSVITAYRCH 502 +AVGM AA+ D++IT+YR H Sbjct: 102 LAVGMEAAITKKDAIITSYRDH 123 >At1g01090.1 68414.m00011 pyruvate dehydrogenase E1 component alpha subunit, chloroplast identical to pyruvate dehydrogenase E1 alpha subunit GB:AAB86803 GI:2454182 from [Arabidopsis thaliana]; identical to cDNA pyruvate dehydrogenase E1 alpha subunit mRNA, nuclear gene encoding plastid protein GI:2454181 Length = 428 Score = 82.6 bits (195), Expect = 3e-16 Identities = 43/93 (46%), Positives = 55/93 (59%), Gaps = 8/93 (8%) Frame = +1 Query: 520 GVSVLGVLSELTGRRTGCSRGKGGSMHLYGR--NFYGGNGIVGAQVPLGAGVAFAHKYRA 693 GVS V+SEL G+ TGC RG+GGSMH++ + N GG +G +P+ G AF+ KYR Sbjct: 151 GVSARAVMSELFGKVTGCCRGQGGSMHMFSKEHNMLGGFAFIGEGIPVATGAAFSSKYRR 210 Query: 694 D------GGVTFALYGDGAANQGQLFEAYTCLN 774 + VT A +GDG N GQ FE CLN Sbjct: 211 EVLKQDCDDVTVAFFGDGTCNNGQFFE---CLN 240 Score = 60.5 bits (140), Expect = 1e-09 Identities = 28/70 (40%), Positives = 41/70 (58%) Frame = +2 Query: 293 TSATLTSEDALKLYEQLTILRRIETASGNLYKEKIIRGFCHLYSGQEAVAVGMRAAMRDA 472 TS +T E+ L+LYE + + R E +Y + GF HLY+GQEAV+ G + + Sbjct: 75 TSLLITKEEGLELYEDMILGRSFEDMCAQMYYRGKMFGFVHLYNGQEAVSTGFIKLLTKS 134 Query: 473 DSVITAYRCH 502 DSV++ YR H Sbjct: 135 DSVVSTYRDH 144 >At5g56330.1 68418.m07031 carbonic anhydrase family protein contains proline-rich extensin domains, INTERPRO:IPR002965; contains Pfam profile PF00194: Eukaryotic-type carbonic anhydrase Length = 350 Score = 35.5 bits (78), Expect = 0.041 Identities = 20/62 (32%), Positives = 27/62 (43%) Frame = -2 Query: 704 TPPSARYLWAKATPAPNGTCAPTIPLPP*KLRPYKCMEPPLPREQPVLRPVSSESTPSTL 525 TPP + A P P APT P P +P PP P+ +P P + + TP+ Sbjct: 49 TPPKPKPKPAPTPPKPKPAPAPTPPKP----KPAPAPTPPKPKPKPAPTPPNPKPTPAPT 104 Query: 524 TP 519 P Sbjct: 105 PP 106 Score = 32.7 bits (71), Expect = 0.29 Identities = 19/61 (31%), Positives = 24/61 (39%) Frame = -2 Query: 701 PPSARYLWAKATPAPNGTCAPTIPLPP*KLRPYKCMEPPLPREQPVLRPVSSESTPSTLT 522 PP + A P P T APT P P +P PP P+ P P + P+ Sbjct: 28 PPKPKPAPAPTPPKPKPTPAPTPPKP----KPKPAPTPPKPKPAPAPTPPKPKPAPAPTP 83 Query: 521 P 519 P Sbjct: 84 P 84 Score = 30.7 bits (66), Expect = 1.2 Identities = 18/58 (31%), Positives = 23/58 (39%) Frame = -2 Query: 704 TPPSARYLWAKATPAPNGTCAPTIPLPP*KLRPYKCMEPPLPREQPVLRPVSSESTPS 531 TPP + A P P APT P P +P PP P+ P P + P+ Sbjct: 60 TPPKPKPAPAPTPPKPKPAPAPTPPKP----KPKPAPTPPNPKPTPAPTPPKPKPAPA 113 Score = 28.3 bits (60), Expect = 6.2 Identities = 17/50 (34%), Positives = 20/50 (40%) Frame = -2 Query: 704 TPPSARYLWAKATPAPNGTCAPTIPLPP*KLRPYKCMEPPLPREQPVLRP 555 TPP + A P P APT P P +P PP P+ P P Sbjct: 71 TPPKPKPAPAPTPPKPKPKPAPTPPNP----KPTPAPTPPKPKPAPAPAP 116 >At4g16980.1 68417.m02560 arabinogalactan-protein family similar to arabinogalactan protein [Arabidopsis thaliana] gi|10880495|gb|AAG24277; contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 164 Score = 35.1 bits (77), Expect = 0.054 Identities = 18/60 (30%), Positives = 26/60 (43%) Frame = -2 Query: 701 PPSARYLWAKATPAPNGTCAPTIPLPP*KLRPYKCMEPPLPREQPVLRPVSSESTPSTLT 522 PP TP P P +P+ P P PP+P P + P++ ++PS LT Sbjct: 50 PPPVMSPMPMMTPPPMPMTPPPMPMTP---PPMPMAPPPMPMASPPMMPMTPSTSPSPLT 106 >At4g12470.1 68417.m01972 protease inhibitor/seed storage/lipid transfer protein (LTP) family protein similar to pEARLI 1 (Accession No. L43080): an Arabidopsis member of a conserved gene family (PGF95-099), Plant Physiol. 109 (4), 1497 (1995); contains Pfam protease inhibitor/seed storage/LTP family domain PF00234 Length = 161 Score = 31.9 bits (69), Expect = 0.50 Identities = 20/56 (35%), Positives = 27/56 (48%), Gaps = 4/56 (7%) Frame = -2 Query: 683 LWAKATPAPNGTCAPTI---PLPP*KLRPYKCMEPPLPR-EQPVLRPVSSESTPST 528 L+ T A N C P+ P+P K +P +C PP P P RPV+ TP + Sbjct: 18 LFFTLTVATNCNCKPSPKPKPVPSPKPKPVQCPPPPRPSVPSPNPRPVTPPRTPGS 73 >At3g24550.1 68416.m03083 protein kinase family protein contains Pfam domain PF00069: Protein kinase domain Length = 652 Score = 31.5 bits (68), Expect = 0.66 Identities = 21/65 (32%), Positives = 27/65 (41%), Gaps = 1/65 (1%) Frame = -2 Query: 710 NVTPPSARYLWAKATPAPNGTCAPTIPLPP*KLRPYKCMEPPLPREQPVLRPV-SSESTP 534 ++ PPS P P+ + AP P PP P PP P + P P S+ TP Sbjct: 63 SLPPPSPPGSLTPPLPQPSPS-APITPSPPSPTTPSNPRSPPSPNQGPPNTPSGSTPRTP 121 Query: 533 STLTP 519 S P Sbjct: 122 SNTKP 126 >At1g21400.1 68414.m02678 2-oxoisovalerate dehydrogenase, putative / 3-methyl-2-oxobutanoate dehydrogenase, putative / branched-chain alpha-keto acid dehydrogenase E1 alpha subunit, putative similar to branched-chain alpha-keto acid dehydrogenase E1-alpha subunit [Gallus gallus] GI:12964598; contains Pfam profile PF00676: Dehydrogenase E1 component Length = 472 Score = 31.5 bits (68), Expect = 0.66 Identities = 18/59 (30%), Positives = 28/59 (47%), Gaps = 4/59 (6%) Frame = +1 Query: 580 GKGGSMHL-YGRN---FYGGNGIVGAQVPLGAGVAFAHKYRADGGVTFALYGDGAANQG 744 GKG M + YG N ++ + + Q+P AGV ++ K T GDG ++G Sbjct: 214 GKGRQMPIHYGSNRLNYFTISSPIATQLPQAAGVGYSLKMDKKNACTVTFIGDGGTSEG 272 >At5g09300.2 68418.m01077 2-oxoisovalerate dehydrogenase, putative / 3-methyl-2-oxobutanoate dehydrogenase, putative / branched-chain alpha-keto acid dehydrogenase E1 alpha subunit, putative similar to branched-chain alpha-keto acid dehydrogenase E1-alpha subunit [Gallus gallus] GI:12964598; contains Pfam profile PF00676: Dehydrogenase E1 component Length = 401 Score = 30.3 bits (65), Expect = 1.5 Identities = 17/83 (20%), Positives = 36/83 (43%), Gaps = 3/83 (3%) Frame = +1 Query: 520 GVSVLGVLSELTGRRTGCSRGKGGSMHLYGRN---FYGGNGIVGAQVPLGAGVAFAHKYR 690 G ++ ++ G ++ +G+ +H YG N ++ + + Q+P G A++ K Sbjct: 125 GFTLQEFANQCFGNKSDYGKGRQMPVH-YGSNKLNYFTVSATIATQLPNAVGAAYSLKMD 183 Query: 691 ADGGVTFALYGDGAANQGQLFEA 759 +GDG ++G A Sbjct: 184 KKDACAVTYFGDGGTSEGDFHAA 206 >At5g09300.1 68418.m01078 2-oxoisovalerate dehydrogenase, putative / 3-methyl-2-oxobutanoate dehydrogenase, putative / branched-chain alpha-keto acid dehydrogenase E1 alpha subunit, putative similar to branched-chain alpha-keto acid dehydrogenase E1-alpha subunit [Gallus gallus] GI:12964598; contains Pfam profile PF00676: Dehydrogenase E1 component Length = 472 Score = 30.3 bits (65), Expect = 1.5 Identities = 17/83 (20%), Positives = 36/83 (43%), Gaps = 3/83 (3%) Frame = +1 Query: 520 GVSVLGVLSELTGRRTGCSRGKGGSMHLYGRN---FYGGNGIVGAQVPLGAGVAFAHKYR 690 G ++ ++ G ++ +G+ +H YG N ++ + + Q+P G A++ K Sbjct: 196 GFTLQEFANQCFGNKSDYGKGRQMPVH-YGSNKLNYFTVSATIATQLPNAVGAAYSLKMD 254 Query: 691 ADGGVTFALYGDGAANQGQLFEA 759 +GDG ++G A Sbjct: 255 KKDACAVTYFGDGGTSEGDFHAA 277 >At4g15560.1 68417.m02377 1-deoxy-D-xylulose 5-phosphate synthase, putative / 1-deoxyxylulose-5-phosphate synthase, putative / DXP-synthase, putative (DEF) (CLA1) identical to SP|Q38854 Probable 1-deoxy-D-xylulose 5-phosphate synthase, chloroplast precursor (EC 4.1.3.37) (1-deoxyxylulose-5-phosphate synthase) (DXP synthase) (DXPS). [Mouse-ear cress] {Arabidopsis thaliana}, DEF (deficient in photosynthesis) protein [Arabidopsis thaliana] GI:1399261 Length = 717 Score = 30.3 bits (65), Expect = 1.5 Identities = 15/51 (29%), Positives = 20/51 (39%) Frame = +1 Query: 625 GNGIVGAQVPLGAGVAFAHKYRADGGVTFALYGDGAANQGQLFEAYTCLNY 777 G G + G G+A + A+ GDGA GQ +EA Y Sbjct: 185 GTGHSSTTISAGLGMAVGRDLKGKNNNVVAVIGDGAMTAGQAYEAMNNAGY 235 >At4g18670.1 68417.m02762 leucine-rich repeat family protein / extensin family protein similar to extensin-like protein [Lycopersicon esculentum] gi|5917664|gb|AAD55979; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 839 Score = 29.9 bits (64), Expect = 2.0 Identities = 21/55 (38%), Positives = 24/55 (43%), Gaps = 5/55 (9%) Frame = -2 Query: 668 TP-APNGTCAPTIPLPP*K-LRPYKCMEPPLPR---EQPVLRPVSSESTPSTLTP 519 TP +P P IP PP P PPLP P++ P S PST TP Sbjct: 569 TPISPGQNSPPIIPSPPFTGPSPPSSPSPPLPPVIPSPPIVGPTPSSPPPSTPTP 623 Score = 28.7 bits (61), Expect = 4.7 Identities = 15/46 (32%), Positives = 21/46 (45%) Frame = -2 Query: 665 PAPNGTCAPTIPLPP*KLRPYKCMEPPLPREQPVLRPVSSESTPST 528 P+P+ + +P I +P P PP P P+ S TPST Sbjct: 521 PSPSISPSPPITVPSPPSTPTSPGSPPSPSSPTPSSPIPSPPTPST 566 >At3g22120.1 68416.m02792 protease inhibitor/seed storage/lipid transfer protein (LTP) family protein similar to SP|Q00451|PRF1_LYCES 36.4 kDa proline-rich protein Lycopersicon esculentum, proline-rich cell wall protein [Medicago sativa] GI:3818416; contains Pfam profile PF00234 Protease inhibitor/seed storage/LTP family Length = 334 Score = 29.9 bits (64), Expect = 2.0 Identities = 17/49 (34%), Positives = 19/49 (38%) Frame = -2 Query: 665 PAPNGTCAPTIPLPP*KLRPYKCMEPPLPREQPVLRPVSSESTPSTLTP 519 P P+ PT PP +P PP P P P TP T TP Sbjct: 134 PPPSTPKPPTTKPPPSTPKPPHHKPPPTPCPPPTPTPTPPVVTPPTPTP 182 >At1g71980.1 68414.m08320 protease-associated zinc finger (C3HC4-type RING finger) family protein identical to ReMembR-H2 protein JR702 [Arabidopsis thaliana] gi|6942149|gb|AAF32326; contains Pfam domain, PF02225: protease-associated (PA) domain and Pfam domain, PF00097: Zinc finger, C3HC4 type (RING finger); identical to cDNA ReMembR-H2 protein JR702 mRNA, partial cds GI:6942148 Length = 448 Score = 29.9 bits (64), Expect = 2.0 Identities = 13/44 (29%), Positives = 20/44 (45%) Frame = +2 Query: 506 WLISWALVCWGCSRS*RGAGPVAPGAREVPCICTDATSMVATGL 637 WL SW C C R R + P + P + + A+S ++ L Sbjct: 262 WLTSWRTFCPVCKRDARTSTGEPPASESTPLLSSAASSFTSSSL 305 >At1g20130.1 68414.m02518 family II extracellular lipase, putative contains Pfam profile PF00657: GDSL-like Lipase/Acylhydrolase; similar to EXL3 (PMID:11431566) Length = 1006 Score = 29.9 bits (64), Expect = 2.0 Identities = 20/63 (31%), Positives = 23/63 (36%) Frame = -2 Query: 707 VTPPSARYLWAKATPAPNGTCAPTIPLPP*KLRPYKCMEPPLPREQPVLRPVSSESTPST 528 V PP+ K P P P P PP +P C PP P P +PV P Sbjct: 63 VPPPACPPTPPKPQPKPAPPPEPK-PAPPPAPKPVPCPSPPKP-PAPTPKPVPPHGPPPK 120 Query: 527 LTP 519 P Sbjct: 121 PAP 123 Score = 27.9 bits (59), Expect = 8.2 Identities = 17/49 (34%), Positives = 18/49 (36%) Frame = -2 Query: 665 PAPNGTCAPTIPLPP*KLRPYKCMEPPLPREQPVLRPVSSESTPSTLTP 519 P P C PT P P K P P P P +PV S P P Sbjct: 62 PVPPPACPPTPPKPQPKPAP---PPEPKPAPPPAPKPVPCPSPPKPPAP 107 >At5g38560.1 68418.m04662 protein kinase family protein contains protein kinase domain, Pfam:PF00069 Length = 681 Score = 29.5 bits (63), Expect = 2.7 Identities = 19/51 (37%), Positives = 23/51 (45%), Gaps = 1/51 (1%) Frame = -2 Query: 668 TPAPNGTCAPTIPLP-P*KLRPYKCMEPPLPREQPVLRPVSSESTPSTLTP 519 TP+P G P+ P P P P PP P P S+ + PSTL P Sbjct: 145 TPSPPGE-TPSPPKPSPSTPTPTTTTSPPPPPATSASPPSSNPTDPSTLAP 194 >At5g14920.1 68418.m01750 gibberellin-regulated family protein similar to SP|P46689 Gibberellin-regulated protein 1 precursor {Arabidopsis thaliana}; contains Pfam profile PF02704: Gibberellin regulated protein Length = 275 Score = 29.5 bits (63), Expect = 2.7 Identities = 14/44 (31%), Positives = 22/44 (50%), Gaps = 1/44 (2%) Frame = -2 Query: 641 PTIPLP-P*KLRPYKCMEPPLPREQPVLRPVSSESTPSTLTPMR 513 PT+P P P P ++PP P +P P + P+T P++ Sbjct: 36 PTLPSPSPATKPPSPALKPPTPSYKPPTLPTTPIKPPTTKPPVK 79 >At3g50580.1 68416.m05532 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 265 Score = 29.5 bits (63), Expect = 2.7 Identities = 19/61 (31%), Positives = 28/61 (45%), Gaps = 3/61 (4%) Frame = -2 Query: 704 TPPSARYLWAKATP--APNGTCAPTIPLPP*KLRPYK-CMEPPLPREQPVLRPVSSESTP 534 +PPS TP +P+ P++P P K P + PP P++ P P S+P Sbjct: 109 SPPSLTPFVPHPTPKKSPSPPPTPSLPPPAPKKSPSTPSLPPPTPKKSPPPPPSHHSSSP 168 Query: 533 S 531 S Sbjct: 169 S 169 >At1g79730.1 68414.m09300 hydroxyproline-rich glycoprotein family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 589 Score = 29.5 bits (63), Expect = 2.7 Identities = 16/41 (39%), Positives = 19/41 (46%) Frame = -2 Query: 701 PPSARYLWAKATPAPNGTCAPTIPLPP*KLRPYKCMEPPLP 579 PPS L A P P + P +P PP +PY PP P Sbjct: 14 PPSQNSL---APPPPPPSLPPPVPPPPPSHQPYSYPPPPPP 51 >At5g60730.1 68418.m07620 anion-transporting ATPase family protein low similarity to SP|O43681 Arsenical pump-driving ATPase (EC 3.6.3.16) (Arsenite-translocating ATPase) (Arsenical resistance ATPase) (Arsenite-transporting ATPase) (ARSA) (ASNA-I) {Homo sapiens}; contains Pfam profile PF02374: Anion-transporting ATPase Length = 391 Score = 29.1 bits (62), Expect = 3.5 Identities = 21/54 (38%), Positives = 24/54 (44%), Gaps = 1/54 (1%) Frame = +2 Query: 185 ESDCTGCSDKRKIQHEKRGDIRNQ-PYKLHKLDQGPATSATLTSEDALKLYEQL 343 ESDC CS +RK Q G I+N KL Q P A + ALK L Sbjct: 335 ESDCKFCSIRRKEQTRVLGLIQNDTELSGLKLIQSPLLDAEIRGVPALKFMGDL 388 >At4g22470.1 68417.m03245 protease inhibitor/seed storage/lipid transfer protein (LTP) family protein similar to hydroxyproline-rich glycoprotein DZ-HRGP from Volvox carteri f. nagariensis GP|6523547; contains Pfam profile PF00234 Protease inhibitor/seed storage/LTP family Length = 375 Score = 29.1 bits (62), Expect = 3.5 Identities = 20/54 (37%), Positives = 24/54 (44%), Gaps = 3/54 (5%) Frame = -2 Query: 707 VTPPSARYLWAKATPAPNGTCAPTI---PLPP*KLRPYKCMEPPLPREQPVLRP 555 +TPP + A P P T P + PLPP L P + PP P P L P Sbjct: 118 ITPPLSPPPPAITPPPPLATTPPALPPKPLPP-PLSPPQTTPPPPPAITPPLSP 170 >At1g62440.1 68414.m07044 leucine-rich repeat family protein / extensin family protein similar to extensin-like protein [Lycopersicon esculentum] gi|5917664|gb|AAD55979; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 826 Score = 29.1 bits (62), Expect = 3.5 Identities = 26/72 (36%), Positives = 36/72 (50%), Gaps = 9/72 (12%) Frame = -2 Query: 719 YRANVTPPSARYLWA-KATPAP-NGTCAP----TIPLPP*KLRP-YKCMEPPLP--REQP 567 +RA PPS++ + +ATP P + +P T P P K+ P K PP P +P Sbjct: 452 FRATPPPPSSKMSPSFRATPPPPSSKMSPSFRATPPPPSSKMSPSVKAYPPPPPPPEYEP 511 Query: 566 VLRPVSSESTPS 531 P SSE +PS Sbjct: 512 SPPPPSSEMSPS 523 >At5g10430.1 68418.m01209 arabinogalactan-protein (AGP4) identical to gi_3883126_gb_AAC77826 Length = 135 Score = 28.7 bits (61), Expect = 4.7 Identities = 22/64 (34%), Positives = 25/64 (39%), Gaps = 2/64 (3%) Frame = -2 Query: 704 TPPSARYLWAKATPAPNGTCAPTIPLPP*KLRPYKCMEPPLPREQPVLRPVSSESTPS-- 531 TPP ATP P T AP P PP P PP P P +S P Sbjct: 36 TPPPVATPPPVATPPPAATPAPATP-PP-AATPAPATTPPSVAPSPADVPTASPPAPEGP 93 Query: 530 TLTP 519 T++P Sbjct: 94 TVSP 97 >At3g58510.2 68416.m06522 DEAD box RNA helicase, putative (RH11) similar to RNA helicase DBY protein [Mus musculus] GI:3790186, SP|O00571 DEAD-box protein 3 (Helicase-like protein 2) {Homo sapiens}; contains Pfam profiles PF00270: DEAD/DEAH box helicase, PF00271: Helicase conserved C-terminal domain; identical to cDNA DEAD box RNA helicase, RH11 GI:3775998 Length = 612 Score = 28.7 bits (61), Expect = 4.7 Identities = 18/40 (45%), Positives = 18/40 (45%), Gaps = 1/40 (2%) Frame = +1 Query: 562 RTGCSRGKGGSMHLYGRNFYGGNGIVGA-QVPLGAGVAFA 678 R G G GG YG YGG G GA GAGV A Sbjct: 571 RGGGGGGGGGGSDYYGGGGYGGGGYGGAPSGGYGAGVTSA 610 >At3g58510.1 68416.m06521 DEAD box RNA helicase, putative (RH11) similar to RNA helicase DBY protein [Mus musculus] GI:3790186, SP|O00571 DEAD-box protein 3 (Helicase-like protein 2) {Homo sapiens}; contains Pfam profiles PF00270: DEAD/DEAH box helicase, PF00271: Helicase conserved C-terminal domain; identical to cDNA DEAD box RNA helicase, RH11 GI:3775998 Length = 612 Score = 28.7 bits (61), Expect = 4.7 Identities = 18/40 (45%), Positives = 18/40 (45%), Gaps = 1/40 (2%) Frame = +1 Query: 562 RTGCSRGKGGSMHLYGRNFYGGNGIVGA-QVPLGAGVAFA 678 R G G GG YG YGG G GA GAGV A Sbjct: 571 RGGGGGGGGGGSDYYGGGGYGGGGYGGAPSGGYGAGVTSA 610 >At3g56410.2 68416.m06274 expressed protein Length = 1535 Score = 28.7 bits (61), Expect = 4.7 Identities = 18/49 (36%), Positives = 25/49 (51%), Gaps = 6/49 (12%) Frame = +2 Query: 608 DATSMVATGL--LVRRFRWEPEWPSPTSTAP----TGESRSLCTETEPP 736 DATS G ++ RWEP+ T+T P + ++RSL E E P Sbjct: 81 DATSYKCGGCDSILHAKRWEPDGNDHTNTIPEALLSSQNRSLSAEVESP 129 >At3g56410.1 68416.m06273 expressed protein Length = 1488 Score = 28.7 bits (61), Expect = 4.7 Identities = 18/49 (36%), Positives = 25/49 (51%), Gaps = 6/49 (12%) Frame = +2 Query: 608 DATSMVATGL--LVRRFRWEPEWPSPTSTAP----TGESRSLCTETEPP 736 DATS G ++ RWEP+ T+T P + ++RSL E E P Sbjct: 34 DATSYKCGGCDSILHAKRWEPDGNDHTNTIPEALLSSQNRSLSAEVESP 82 >At1g26150.1 68414.m03192 protein kinase family protein similar to Pto kinase interactor 1 GI:3668069 from [Lycopersicon esculentum] Length = 760 Score = 28.7 bits (61), Expect = 4.7 Identities = 17/49 (34%), Positives = 20/49 (40%) Frame = -2 Query: 665 PAPNGTCAPTIPLPP*KLRPYKCMEPPLPREQPVLRPVSSESTPSTLTP 519 P P T AP P P PP P E P P++S S P+ P Sbjct: 101 PPPLPTEAPPPANPVSSPPPESSPPPPPPTEAPPTTPITSPSPPTNPPP 149 >At4g01985.1 68417.m00265 expressed protein Length = 579 Score = 28.3 bits (60), Expect = 6.2 Identities = 26/67 (38%), Positives = 30/67 (44%), Gaps = 4/67 (5%) Frame = +1 Query: 556 GRRTGCSRGKGGSMHLYGRNFYGG--NGIVGAQV--PLGAGVAFAHKYRADGGVTFALYG 723 G TG S G GG + + G GG G VG V +G GV A GGV A G Sbjct: 471 GGGTGGSVGAGGGVGVGGGGGIGGGAGGGVGGGVGGGVGGGVRGAVGGAVGGGVGGAGRG 530 Query: 724 DGAANQG 744 G A+ G Sbjct: 531 SGGASGG 537 >At2g43680.2 68415.m05430 calmodulin-binding family protein similar to SF16 protein [Helianthus annuus] GI:560150; contains Pfam profile PF00612: IQ calmodulin-binding motif Length = 669 Score = 28.3 bits (60), Expect = 6.2 Identities = 20/63 (31%), Positives = 24/63 (38%) Frame = -2 Query: 701 PPSARYLWAKATPAPNGTCAPTIPLPP*KLRPYKCMEPPLPREQPVLRPVSSESTPSTLT 522 PPS R +A P PT P PP L ++ P P +P S S P L Sbjct: 230 PPSPRAASLRADPPRLDAARPTTPRPPSPLADAPRLDAPRPTTP---KPPSPRSDPPRLD 286 Query: 521 PMR 513 R Sbjct: 287 APR 289 >At2g43680.1 68415.m05429 calmodulin-binding family protein similar to SF16 protein [Helianthus annuus] GI:560150; contains Pfam profile PF00612: IQ calmodulin-binding motif Length = 668 Score = 28.3 bits (60), Expect = 6.2 Identities = 20/63 (31%), Positives = 24/63 (38%) Frame = -2 Query: 701 PPSARYLWAKATPAPNGTCAPTIPLPP*KLRPYKCMEPPLPREQPVLRPVSSESTPSTLT 522 PPS R +A P PT P PP L ++ P P +P S S P L Sbjct: 229 PPSPRAASLRADPPRLDAARPTTPRPPSPLADAPRLDAPRPTTP---KPPSPRSDPPRLD 285 Query: 521 PMR 513 R Sbjct: 286 APR 288 >At2g39650.1 68415.m04862 expressed protein contains Pfam profile PF04720: Protein of unknown function (DUF506) Length = 291 Score = 28.3 bits (60), Expect = 6.2 Identities = 16/63 (25%), Positives = 32/63 (50%), Gaps = 2/63 (3%) Frame = +3 Query: 123 IDKMSKLIPSAAKFLAGNTITKVTA--PVVATNAKYSTKKEATFEISPTNSINWIRALQH 296 +D +++ S G T+ ++ V+ AK+S K+ + + P S+N++R+ H Sbjct: 177 VDSYQRIMESLPVVYVG-TVARLNQFLQVMVDAAKFSLKQNS-MPLPPWRSLNYLRSKWH 234 Query: 297 QPH 305 PH Sbjct: 235 SPH 237 >At1g53180.1 68414.m06027 expressed protein Length = 358 Score = 28.3 bits (60), Expect = 6.2 Identities = 23/54 (42%), Positives = 25/54 (46%), Gaps = 1/54 (1%) Frame = +1 Query: 403 WFLSPVFRTRSRGSRYESSDARCRLSDHRVSLSRMAYLMGVSVLG-VLSELTGR 561 WF +F RSRG RY SD S S S MG S +G VL TGR Sbjct: 19 WFFENLFTRRSRGLRYCHSDPYPSSS----STSTSPEKMGDSDIGKVLEASTGR 68 >At5g13660.1 68418.m01590 expressed protein Length = 537 Score = 27.9 bits (59), Expect = 8.2 Identities = 14/44 (31%), Positives = 24/44 (54%) Frame = -1 Query: 711 ERDSPVGAVLVGEGHSGSQRNLRTNNPVATIEVASVQMHGTSLA 580 E+ +PV + + H GS NL T N V+ + VQ++G ++ Sbjct: 96 EQCNPVSSFGLPLAHHGSSFNLDTINKVSNVPEFMVQLYGQGIS 139 >At3g58570.1 68416.m06528 DEAD box RNA helicase, putative similar to SP|O00571 DEAD-box protein 3 (Helicase-like protein 2) {Homo sapiens}, DEAD box RNA helicase DDX3 [Homo sapiens] GI:3523150; contains Pfam profiles PF00270: DEAD/DEAH box helicase, PF00271: Helicase conserved C-terminal domain Length = 646 Score = 27.9 bits (59), Expect = 8.2 Identities = 23/59 (38%), Positives = 27/59 (45%), Gaps = 2/59 (3%) Frame = +1 Query: 559 RRTGCSRGKGGSMHLYGRNFYGG--NGIVGAQVPLGAGVAFAHKYRADGGVTFALYGDG 729 RR SRG GG+ + G YGG G GA +P G G Y G +A YG G Sbjct: 562 RRESFSRGGGGADYYGGGGGYGGVPGGGYGA-MPGGYGPVPGGGYGNVPGGGYAPYGRG 619 >At3g21500.2 68416.m02713 1-deoxy-D-xylulose 5-phosphate synthase, putative / 1-deoxyxylulose-5-phosphate synthase, putative / DXP-synthase, putative strong similarity to 1-D-deoxyxylulose 5-phosphate synthase [Lycopersicon esculentum] GI:5059160, DEF (deficient in photosynthesis) protein [Arabidopsis thaliana] GI:1399261; ; contains Pfam profiles PF02779: Transketolase, pyridine binding domain, PF02780: Transketolase, C-terminal domain Length = 629 Score = 27.9 bits (59), Expect = 8.2 Identities = 14/51 (27%), Positives = 20/51 (39%) Frame = +1 Query: 625 GNGIVGAQVPLGAGVAFAHKYRADGGVTFALYGDGAANQGQLFEAYTCLNY 777 G G + G G+A + ++ GDGA GQ +EA Y Sbjct: 163 GTGHSSTTLSAGLGMAVGRDLKGMNNSVVSVIGDGAMTAGQAYEAMNNAGY 213 >At3g21500.1 68416.m02712 1-deoxy-D-xylulose 5-phosphate synthase, putative / 1-deoxyxylulose-5-phosphate synthase, putative / DXP-synthase, putative strong similarity to 1-D-deoxyxylulose 5-phosphate synthase [Lycopersicon esculentum] GI:5059160, DEF (deficient in photosynthesis) protein [Arabidopsis thaliana] GI:1399261; ; contains Pfam profiles PF02779: Transketolase, pyridine binding domain, PF02780: Transketolase, C-terminal domain Length = 628 Score = 27.9 bits (59), Expect = 8.2 Identities = 14/51 (27%), Positives = 20/51 (39%) Frame = +1 Query: 625 GNGIVGAQVPLGAGVAFAHKYRADGGVTFALYGDGAANQGQLFEAYTCLNY 777 G G + G G+A + ++ GDGA GQ +EA Y Sbjct: 163 GTGHSSTTLSAGLGMAVGRDLKGMNNSVVSVIGDGAMTAGQAYEAMNNAGY 213 >At2g25737.1 68415.m03087 expressed protein contains Pfam profile: PF01925 domain of unknown function DUF81 Length = 476 Score = 27.9 bits (59), Expect = 8.2 Identities = 22/73 (30%), Positives = 35/73 (47%), Gaps = 5/73 (6%) Frame = +1 Query: 463 ARCRLSDHRVSLSRMAYLMGVSVLGVLSELTGRRTGCSRGKGGSMHLYGR-----NFYGG 627 A C ++ ++L ++ +GVS ++ GRR S+G+G S G+ F Sbjct: 283 ANCSVAYWVINLLQIPVAVGVSGYEAVALYQGRRIIASKGQGDSNFTVGQLVMYCTFGII 342 Query: 628 NGIVGAQVPLGAG 666 GIVG + LG G Sbjct: 343 AGIVGGLLGLGGG 355 >At1g26110.1 68414.m03186 expressed protein Length = 611 Score = 27.9 bits (59), Expect = 8.2 Identities = 25/83 (30%), Positives = 32/83 (38%) Frame = +1 Query: 451 ESSDARCRLSDHRVSLSRMAYLMGVSVLGVLSELTGRRTGCSRGKGGSMHLYGRNFYGGN 630 ES ++R R S+ R + G S G R G RG G + Y R YGG Sbjct: 531 ESQNSRPRFSEQRK--------LDTETFGEFSRFRGGRGG--RGGYGRNNGYSRGGYGGR 580 Query: 631 GIVGAQVPLGAGVAFAHKYRADG 699 G G G G + + R G Sbjct: 581 GYGGYGGRGGGGGGYGYGGRGQG 603 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,190,446 Number of Sequences: 28952 Number of extensions: 371300 Number of successful extensions: 1263 Number of sequences better than 10.0: 39 Number of HSP's better than 10.0 without gapping: 1097 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1243 length of database: 12,070,560 effective HSP length: 80 effective length of database: 9,754,400 effective search space used: 1785055200 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -