BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30979 (804 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 05_03_0364 + 13007002-13007538,13007965-13008393,13008649-130089... 32 0.61 09_03_0191 - 13322141-13322458,13322767-13323033,13324836-133250... 28 7.6 >05_03_0364 + 13007002-13007538,13007965-13008393,13008649-13008990, 13009904-13010035,13010432-13010596 Length = 534 Score = 31.9 bits (69), Expect = 0.61 Identities = 17/57 (29%), Positives = 28/57 (49%) Frame = -1 Query: 198 ALISSMAPSSAALRIFARSALATSDILLSFLFCCDRTKTFSSSRFFRIYNIPLMVKV 28 A+I+ PS AL + +L D +L FL C + + RIY++PL + + Sbjct: 153 AMITHPKPSEEALIVPTNKSLVLQDSMLLFLTCPSKVPLEVVPIWIRIYDLPLALMI 209 >09_03_0191 - 13322141-13322458,13322767-13323033,13324836-13325048, 13325153-13325349,13325432-13325636 Length = 399 Score = 28.3 bits (60), Expect = 7.6 Identities = 15/50 (30%), Positives = 26/50 (52%), Gaps = 2/50 (4%) Frame = +3 Query: 576 LIENRLLKLIEKYQPVS--RNLCTLDAIFMALDIQAEEDIEILCKTFLNY 719 ++ L KLI + S R L + + ++L+ Q +ED+ +L F NY Sbjct: 188 MVSEALSKLISRLNIESKIRTLTDKEELVLSLERQYQEDVGVLAALFFNY 237 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,790,428 Number of Sequences: 37544 Number of extensions: 272009 Number of successful extensions: 614 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 598 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 614 length of database: 14,793,348 effective HSP length: 81 effective length of database: 11,752,284 effective search space used: 2185924824 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -