BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30978 (478 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value X52884-1|CAA37066.1| 461|Apis mellifera elongation factor 1 alp... 22 2.9 AY208278-1|AAO48970.1| 274|Apis mellifera elongation factor 1-a... 22 3.9 AF134816-1|AAD40232.1| 50|Apis mellifera unknown protein. 22 3.9 AF015267-1|AAC38959.1| 461|Apis mellifera elongation factor-1al... 22 3.9 AF498306-5|AAM19330.1| 456|Apis mellifera dopamine receptor typ... 21 5.1 AF441189-1|AAL73401.1| 134|Apis mellifera ribosomal protein 49 ... 21 6.8 >X52884-1|CAA37066.1| 461|Apis mellifera elongation factor 1 alpha protein. Length = 461 Score = 22.2 bits (45), Expect = 2.9 Identities = 9/31 (29%), Positives = 14/31 (45%) Frame = +3 Query: 258 WIQDCWGGSRESGCCSYVIHWECLSCQYYCT 350 W+ D RE G + W+ + +YY T Sbjct: 58 WVLDKLKAERERGITIDIALWKFETAKYYVT 88 >AY208278-1|AAO48970.1| 274|Apis mellifera elongation factor 1-alpha protein. Length = 274 Score = 21.8 bits (44), Expect = 3.9 Identities = 9/31 (29%), Positives = 14/31 (45%) Frame = +3 Query: 258 WIQDCWGGSRESGCCSYVIHWECLSCQYYCT 350 W+ D RE G + W+ + +YY T Sbjct: 1 WVLDKLKAERERGITIDIALWKFETSKYYVT 31 >AF134816-1|AAD40232.1| 50|Apis mellifera unknown protein. Length = 50 Score = 21.8 bits (44), Expect = 3.9 Identities = 7/17 (41%), Positives = 11/17 (64%) Frame = +2 Query: 86 YSRNCHTRPKQHNRYIY 136 ++ +C +PK HN IY Sbjct: 23 WALDCSIKPKDHNGSIY 39 >AF015267-1|AAC38959.1| 461|Apis mellifera elongation factor-1alpha F2 protein. Length = 461 Score = 21.8 bits (44), Expect = 3.9 Identities = 9/31 (29%), Positives = 14/31 (45%) Frame = +3 Query: 258 WIQDCWGGSRESGCCSYVIHWECLSCQYYCT 350 W+ D RE G + W+ + +YY T Sbjct: 58 WVLDKLKAERERGITIDIALWKFETSKYYVT 88 >AF498306-5|AAM19330.1| 456|Apis mellifera dopamine receptor type D2 protein. Length = 456 Score = 21.4 bits (43), Expect = 5.1 Identities = 8/16 (50%), Positives = 10/16 (62%) Frame = -2 Query: 462 LYCSKLFFNINLWSRF 415 + C FF +NLWS F Sbjct: 345 IICWLPFFVVNLWSGF 360 >AF441189-1|AAL73401.1| 134|Apis mellifera ribosomal protein 49 protein. Length = 134 Score = 21.0 bits (42), Expect = 6.8 Identities = 7/24 (29%), Positives = 15/24 (62%) Frame = -3 Query: 425 GHGFSNETLHILPLVYHALIILEV 354 G+G + +T H+LP + +++ V Sbjct: 58 GYGSNKKTRHMLPTGFRKVLVHNV 81 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 122,192 Number of Sequences: 438 Number of extensions: 2483 Number of successful extensions: 6 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 146,343 effective HSP length: 53 effective length of database: 123,129 effective search space used: 12928545 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -