BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30978 (478 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g59320.1 68416.m06614 integral membrane protein, putative con... 27 6.6 >At3g59320.1 68416.m06614 integral membrane protein, putative contains Pfam profile PF00892: Integral membrane protein; identical to anthocyanin-related membrane protein 2 (GI:16416385) [Arabidopsis thaliana] Length = 339 Score = 27.1 bits (57), Expect = 6.6 Identities = 21/76 (27%), Positives = 36/76 (47%) Frame = +3 Query: 18 RRVTVKCEWHLFNTIVNVYILRNIPGIVTQDLNNTTAISTVLS*TRTFPQTWVMRVLLVL 197 RR +K +W+ + + V + N +V + NT+ S +L W + +LVL Sbjct: 68 RRSAIKVKWYHYFLLAVVDVEANF--LVVKAFQNTSMTSIMLL------DCWAIPCVLVL 119 Query: 198 SMG*LKSFYGLEKVYG 245 + LK+ Y L K+ G Sbjct: 120 TWVFLKTRYRLMKISG 135 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 9,401,903 Number of Sequences: 28952 Number of extensions: 180616 Number of successful extensions: 410 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 398 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 410 length of database: 12,070,560 effective HSP length: 75 effective length of database: 9,899,160 effective search space used: 821630280 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -