BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30976 (660 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPCC1235.08c |pdh1||DUF1751 family protein|Schizosaccharomyces p... 31 0.19 SPCC162.05 |coq3||hexaprenyldihydroxybenzoate methyltransferase|... 27 1.8 >SPCC1235.08c |pdh1||DUF1751 family protein|Schizosaccharomyces pombe|chr 3|||Manual Length = 226 Score = 30.7 bits (66), Expect = 0.19 Identities = 13/53 (24%), Positives = 25/53 (47%) Frame = -2 Query: 578 LVYFFIKVYLNLNFNHEIWYFFFILISGTT*ETFFFILIPQFYYEVLSILSET 420 L+Y F+ ++L F W +F + +SGT + + + E+ + S T Sbjct: 170 LIYLFLSIHLFYVFQSFPWTYFCLAVSGTCISELYVLFVHPVVQELFHLESHT 222 >SPCC162.05 |coq3||hexaprenyldihydroxybenzoate methyltransferase|Schizosaccharomyces pombe|chr 3|||Manual Length = 271 Score = 27.5 bits (58), Expect = 1.8 Identities = 12/30 (40%), Positives = 18/30 (60%) Frame = +3 Query: 360 MNIKNKYRNLKTYICYIYTGCLRKNR*HLI 449 MNI NK +N+K+Y + G L + R H + Sbjct: 1 MNILNKVKNVKSYTRLVRQGFLSQQRNHSV 30 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,256,392 Number of Sequences: 5004 Number of extensions: 43312 Number of successful extensions: 86 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 80 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 86 length of database: 2,362,478 effective HSP length: 70 effective length of database: 2,012,198 effective search space used: 299817502 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -