BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30976 (660 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AL117206-8|CAB60449.2| 328|Caenorhabditis elegans Hypothetical ... 29 3.9 AC024200-11|AAF36000.1| 271|Caenorhabditis elegans Hypothetical... 28 6.8 >AL117206-8|CAB60449.2| 328|Caenorhabditis elegans Hypothetical protein Y67A10A.8 protein. Length = 328 Score = 28.7 bits (61), Expect = 3.9 Identities = 13/30 (43%), Positives = 18/30 (60%), Gaps = 1/30 (3%) Frame = -1 Query: 405 NIYTFLSSYIYFLY-SFNRHYYV*PKTDSH 319 NI++ L +IYF Y +N +Y V P SH Sbjct: 65 NIWSHLLGFIYFTYQQYNTNYIVLPSIGSH 94 >AC024200-11|AAF36000.1| 271|Caenorhabditis elegans Hypothetical protein Y71F9AL.6 protein. Length = 271 Score = 27.9 bits (59), Expect = 6.8 Identities = 10/25 (40%), Positives = 17/25 (68%) Frame = -1 Query: 414 YIYNIYTFLSSYIYFLYSFNRHYYV 340 YIY+IYT+ S IY ++ + Y++ Sbjct: 45 YIYHIYTYTKSPIYHIHHIYQIYHI 69 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,095,736 Number of Sequences: 27780 Number of extensions: 234538 Number of successful extensions: 407 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 394 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 406 length of database: 12,740,198 effective HSP length: 79 effective length of database: 10,545,578 effective search space used: 1476380920 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -