BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30973X (484 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value DQ383819-1|ABD38144.1| 377|Anopheles gambiae abdominal-B protein. 23 4.2 DQ370040-1|ABD18601.1| 121|Anopheles gambiae putative TIL domai... 22 9.6 >DQ383819-1|ABD38144.1| 377|Anopheles gambiae abdominal-B protein. Length = 377 Score = 23.4 bits (48), Expect = 4.2 Identities = 10/32 (31%), Positives = 15/32 (46%) Frame = +2 Query: 362 PHGNSGSVRAKFKSNLPAQAMGHRIRVMLYPS 457 P GN + + + P A+ I+ M YPS Sbjct: 149 PWGNDSAADYAYHAQYPPYALATDIKPMYYPS 180 >DQ370040-1|ABD18601.1| 121|Anopheles gambiae putative TIL domain polypeptide protein. Length = 121 Score = 22.2 bits (45), Expect = 9.6 Identities = 7/16 (43%), Positives = 12/16 (75%) Frame = -3 Query: 275 THRRNACSIKDCIITV 228 T R+NA + DC++T+ Sbjct: 30 TVRKNAVFVCDCVVTI 45 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 507,663 Number of Sequences: 2352 Number of extensions: 11345 Number of successful extensions: 39 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 39 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 39 length of database: 563,979 effective HSP length: 60 effective length of database: 422,859 effective search space used: 42285900 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -