BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30971 (639 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value CR954257-13|CAJ14164.1| 420|Anopheles gambiae predicted protein... 24 3.5 AY428512-1|AAR89530.1| 420|Anopheles gambiae EKN1 protein. 24 3.5 DQ137801-1|AAZ78362.1| 622|Anopheles gambiae male-specific doub... 23 8.2 >CR954257-13|CAJ14164.1| 420|Anopheles gambiae predicted protein protein. Length = 420 Score = 24.2 bits (50), Expect = 3.5 Identities = 12/39 (30%), Positives = 21/39 (53%) Frame = -2 Query: 515 PPMEISERSQCACQSPGAQ*MMGCSQLACGHEYAFAGSK 399 PP+E + R++ AC + A ++ L G+E A S+ Sbjct: 349 PPVEANRRARVACLARRAAALVKLGFLQQGYEEMIAASR 387 >AY428512-1|AAR89530.1| 420|Anopheles gambiae EKN1 protein. Length = 420 Score = 24.2 bits (50), Expect = 3.5 Identities = 12/39 (30%), Positives = 21/39 (53%) Frame = -2 Query: 515 PPMEISERSQCACQSPGAQ*MMGCSQLACGHEYAFAGSK 399 PP+E + R++ AC + A ++ L G+E A S+ Sbjct: 349 PPVEANRRARVACLARRAAALVKLGFLQQGYEEMIAASR 387 >DQ137801-1|AAZ78362.1| 622|Anopheles gambiae male-specific doublesex protein protein. Length = 622 Score = 23.0 bits (47), Expect = 8.2 Identities = 11/31 (35%), Positives = 17/31 (54%) Frame = -1 Query: 549 EVLPLDTSRTTSTDGDFREKSMCLPESRRTI 457 E++PL S DGD ++ + E +RTI Sbjct: 210 EMMPLMYVILKSADGDVQKAHQRIDEGKRTI 240 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 609,366 Number of Sequences: 2352 Number of extensions: 12554 Number of successful extensions: 21 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 21 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 21 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 62723250 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -