BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30968 (683 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC13C5.07 |rad32|mre11|Rad32 nuclease|Schizosaccharomyces pomb... 29 0.63 SPCC18.13 |||tRNA |Schizosaccharomyces pombe|chr 3|||Manual 26 5.8 SPBC19C7.03 |cyr1|git2|adenylate cyclase|Schizosaccharomyces pom... 26 5.8 SPBC887.04c |lub1||WD repeat protein Lub1|Schizosaccharomyces po... 25 7.7 >SPAC13C5.07 |rad32|mre11|Rad32 nuclease|Schizosaccharomyces pombe|chr 1|||Manual Length = 649 Score = 29.1 bits (62), Expect = 0.63 Identities = 10/24 (41%), Positives = 19/24 (79%) Frame = -3 Query: 279 KNEKLFVSPLILENGWTDLANFGL 208 +N+ + VSP++L+ G+T LA +G+ Sbjct: 163 ENDNIVVSPILLQKGFTKLALYGI 186 >SPCC18.13 |||tRNA |Schizosaccharomyces pombe|chr 3|||Manual Length = 421 Score = 25.8 bits (54), Expect = 5.8 Identities = 11/32 (34%), Positives = 16/32 (50%) Frame = +2 Query: 524 FPPIYCIISI*MKAFEITNCKKLNLINKKQSP 619 F +YC+ E+T KK N++ KQ P Sbjct: 126 FGDVYCVDENWFTTSEVTEEKKSNVVEGKQEP 157 >SPBC19C7.03 |cyr1|git2|adenylate cyclase|Schizosaccharomyces pombe|chr 2|||Manual Length = 1692 Score = 25.8 bits (54), Expect = 5.8 Identities = 12/30 (40%), Positives = 20/30 (66%), Gaps = 1/30 (3%) Frame = +1 Query: 478 SIVSSQICPYLNLVSISPNLL-YYKHLNES 564 +I S CP LN ++++ NLL +Y++ N S Sbjct: 609 NIASLSECPKLNSINVACNLLSFYEYSNPS 638 >SPBC887.04c |lub1||WD repeat protein Lub1|Schizosaccharomyces pombe|chr 2|||Manual Length = 713 Score = 25.4 bits (53), Expect = 7.7 Identities = 10/20 (50%), Positives = 13/20 (65%) Frame = +3 Query: 483 CVVPDLSLFKSSLYFPQSTV 542 C VPD++L S +Y QS V Sbjct: 670 CTVPDIALAASQIYHAQSIV 689 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,507,471 Number of Sequences: 5004 Number of extensions: 47496 Number of successful extensions: 85 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 84 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 85 length of database: 2,362,478 effective HSP length: 70 effective length of database: 2,012,198 effective search space used: 315915086 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -