BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30964 (752 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM292371-1|CAL23183.2| 350|Tribolium castaneum gustatory recept... 23 3.5 EF222292-1|ABN79652.1| 354|Tribolium castaneum cardioactive pep... 22 6.0 AF217810-1|AAF71998.1| 431|Tribolium castaneum fork head orthol... 21 8.0 >AM292371-1|CAL23183.2| 350|Tribolium castaneum gustatory receptor candidate 50 protein. Length = 350 Score = 22.6 bits (46), Expect = 3.5 Identities = 8/19 (42%), Positives = 12/19 (63%) Frame = -2 Query: 646 SFPPIVLLGVLSKSFTTCS 590 S+ PIV G++ F TC+ Sbjct: 160 SYCPIVTTGIIKIQFATCA 178 >EF222292-1|ABN79652.1| 354|Tribolium castaneum cardioactive peptide receptor 2 protein. Length = 354 Score = 21.8 bits (44), Expect = 6.0 Identities = 15/68 (22%), Positives = 35/68 (51%), Gaps = 3/68 (4%) Frame = -2 Query: 280 LFHRMLQNDTELLICGLPAQPTNKKFSVVIASWGLSTVMILRITATVLCISIKLVVG--- 110 LF ++ ++ +L+ L ++ + + I ++ + + I+ + I+ ++ V Sbjct: 56 LFTMIVLGNSAVLVALLVSKSRKSRMNFFICQLAIADLAVGLISVST-DIAWRITVAWYA 114 Query: 109 GNILCKII 86 GN+LCKII Sbjct: 115 GNVLCKII 122 >AF217810-1|AAF71998.1| 431|Tribolium castaneum fork head orthologue protein. Length = 431 Score = 21.4 bits (43), Expect = 8.0 Identities = 8/29 (27%), Positives = 15/29 (51%) Frame = +1 Query: 355 ESIDKVMAAGEHTINNKKVDPKKAKARHG 441 E I + + H+++N KK+ +HG Sbjct: 242 ELIRQTHKSPSHSVDNSNSSEKKSSIQHG 270 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 171,120 Number of Sequences: 336 Number of extensions: 3597 Number of successful extensions: 6 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 122,585 effective HSP length: 56 effective length of database: 103,769 effective search space used: 20131186 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -