BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30964 (752 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g13224.2 68416.m01658 RNA recognition motif (RRM)-containing ... 71 1e-12 At3g13224.1 68416.m01657 RNA recognition motif (RRM)-containing ... 71 1e-12 At5g40490.1 68418.m04910 RNA recognition motif (RRM)-containing ... 63 2e-10 At1g17640.1 68414.m02183 RNA recognition motif (RRM)-containing ... 59 3e-09 At4g14300.1 68417.m02203 heterogeneous nuclear ribonucleoprotein... 56 2e-08 At4g26650.1 68417.m03840 RNA recognition motif (RRM)-containing ... 53 2e-07 At2g33410.1 68415.m04095 heterogeneous nuclear ribonucleoprotein... 53 2e-07 At5g55550.3 68418.m06922 RNA recognition motif (RRM)-containing ... 52 4e-07 At5g55550.2 68418.m06921 RNA recognition motif (RRM)-containing ... 52 4e-07 At5g55550.1 68418.m06920 RNA recognition motif (RRM)-containing ... 52 4e-07 At5g47620.2 68418.m05879 heterogeneous nuclear ribonucleoprotein... 51 9e-07 At5g47620.1 68418.m05878 heterogeneous nuclear ribonucleoprotein... 51 9e-07 At3g07810.2 68416.m00956 heterogeneous nuclear ribonucleoprotein... 48 5e-06 At3g07810.1 68416.m00955 heterogeneous nuclear ribonucleoprotein... 48 5e-06 At4g36960.1 68417.m05238 RNA recognition motif (RRM)-containing ... 48 9e-06 At1g58470.1 68414.m06651 RNA-binding protein (XF41) identical to... 41 2e-05 At5g47620.3 68418.m05877 heterogeneous nuclear ribonucleoprotein... 46 2e-05 At1g76460.1 68414.m08893 RNA recognition motif (RRM)-containing ... 45 6e-05 At1g20880.1 68414.m02615 RNA recognition motif (RRM)-containing ... 44 8e-05 At2g19380.1 68415.m02260 RNA recognition motif (RRM)-containing ... 44 1e-04 At3g15010.2 68416.m01899 RNA recognition motif (RRM)-containing ... 43 2e-04 At3g15010.1 68416.m01898 RNA recognition motif (RRM)-containing ... 43 2e-04 At1g74230.1 68414.m08597 glycine-rich RNA-binding protein simila... 43 3e-04 At5g53720.1 68418.m06676 RNA recognition motif (RRM)-containing ... 42 6e-04 At1g78260.2 68414.m09119 RNA recognition motif (RRM)-containing ... 42 6e-04 At1g78260.1 68414.m09120 RNA recognition motif (RRM)-containing ... 42 6e-04 At1g49760.1 68414.m05580 polyadenylate-binding protein, putative... 42 6e-04 At1g07350.1 68414.m00783 transformer serine/arginine-rich ribonu... 40 0.001 At3g19130.1 68416.m02429 RNA-binding protein, putative similar t... 31 0.001 At2g46780.1 68415.m05836 RNA recognition motif (RRM)-containing ... 40 0.002 At2g22100.1 68415.m02625 RNA recognition motif (RRM)-containing ... 40 0.002 At2g22090.2 68415.m02624 UBP1 interacting protein 1a (UBA1a) nea... 39 0.003 At2g22090.1 68415.m02623 UBP1 interacting protein 1a (UBA1a) nea... 39 0.003 At2g21660.2 68415.m02578 glycine-rich RNA-binding protein (GRP7)... 39 0.003 At2g21660.1 68415.m02577 glycine-rich RNA-binding protein (GRP7)... 39 0.003 At5g61030.1 68418.m07659 RNA-binding protein, putative similar t... 38 0.005 At5g53680.1 68418.m06668 RNA recognition motif (RRM)-containing ... 38 0.005 At4g19610.1 68417.m02881 RNA recognition motif (RRM)-containing ... 38 0.005 At3g26420.1 68416.m03295 glycine-rich RNA-binding protein simila... 38 0.005 At2g37220.1 68415.m04566 29 kDa ribonucleoprotein, chloroplast, ... 38 0.005 At1g22330.1 68414.m02793 RNA recognition motif (RRM)-containing ... 38 0.005 At3g47120.1 68416.m05116 RNA recognition motif (RRM)-containing ... 38 0.007 At5g64200.2 68418.m08063 arginine/serine-rich splicing factor SC... 38 0.009 At5g64200.1 68418.m08062 arginine/serine-rich splicing factor SC... 38 0.009 At4g03110.2 68417.m00421 RNA-binding protein, putative similar t... 38 0.009 At4g03110.1 68417.m00420 RNA-binding protein, putative similar t... 38 0.009 At4g00830.1 68417.m00114 RNA recognition motif (RRM)-containing ... 37 0.012 At1g33470.2 68414.m04143 RNA recognition motif (RRM)-containing ... 37 0.012 At1g33470.1 68414.m04142 RNA recognition motif (RRM)-containing ... 37 0.012 At3g52660.1 68416.m05801 RNA recognition motif (RRM)-containing ... 37 0.017 At3g23830.2 68416.m02996 glycine-rich RNA-binding protein, putat... 37 0.017 At3g23830.1 68416.m02995 glycine-rich RNA-binding protein, putat... 37 0.017 At3g18610.1 68416.m02365 nucleolin, putative contains Pfam profi... 37 0.017 At2g23350.1 68415.m02788 polyadenylate-binding protein, putative... 37 0.017 At5g19350.1 68418.m02306 RNA-binding protein 45 (RBP45), putative 36 0.022 At3g16380.1 68416.m02074 polyadenylate-binding protein, putative... 36 0.022 At2g37510.1 68415.m04600 RNA-binding protein, putative similar t... 36 0.022 At1g22910.3 68414.m02863 RNA recognition motif (RRM)-containing ... 36 0.022 At1g22910.2 68414.m02861 RNA recognition motif (RRM)-containing ... 36 0.022 At1g22910.1 68414.m02862 RNA recognition motif (RRM)-containing ... 36 0.022 At1g22760.1 68414.m02844 polyadenylate-binding protein 3 (PABP3) 36 0.022 At2g41060.1 68415.m05070 RNA recognition motif (RRM)-containing ... 36 0.029 At1g47490.2 68414.m05269 RNA-binding protein 47 (RBP47), putativ... 36 0.029 At1g47490.1 68414.m05270 RNA-binding protein 47 (RBP47), putativ... 36 0.029 At1g01080.1 68414.m00010 33 kDa ribonucleoprotein, chloroplast, ... 36 0.029 At3g56860.3 68416.m06325 UBP1 interacting protein 2a (UBA2a) ide... 36 0.038 At3g56860.2 68416.m06324 UBP1 interacting protein 2a (UBA2a) ide... 36 0.038 At3g56860.1 68416.m06323 UBP1 interacting protein 2a (UBA2a) ide... 36 0.038 At1g07350.2 68414.m00784 transformer serine/arginine-rich ribonu... 36 0.038 At5g04280.1 68418.m00421 glycine-rich RNA-binding protein 35 0.050 At4g39260.3 68417.m05559 glycine-rich RNA-binding protein 8 (GRP... 35 0.050 At4g39260.2 68417.m05558 glycine-rich RNA-binding protein 8 (GRP... 35 0.050 At4g39260.1 68417.m05557 glycine-rich RNA-binding protein 8 (GRP... 35 0.050 At3g52150.1 68416.m05724 RNA recognition motif (RRM)-containing ... 35 0.050 At2g44710.1 68415.m05564 RNA recognition motif (RRM)-containing ... 35 0.050 At2g16260.1 68415.m01862 glycine-rich RNA-binding protein, putat... 35 0.050 At1g48920.1 68414.m05480 nucleolin, putative similar to nuM1 pro... 35 0.050 At1g03457.1 68414.m00326 RNA-binding protein, putative similar t... 35 0.050 At5g09880.1 68418.m01142 RNA recognition motif (RRM)-containing ... 35 0.067 At3g52380.1 68416.m05757 33 kDa ribonucleoprotein, chloroplast, ... 35 0.067 At3g12640.1 68416.m01573 RNA recognition motif (RRM)-containing ... 35 0.067 At3g08000.1 68416.m00977 RNA-binding protein, putative similar t... 35 0.067 At2g36660.1 68415.m04496 polyadenylate-binding protein, putative... 35 0.067 At1g60650.2 68414.m06828 glycine-rich RNA-binding protein, putat... 35 0.067 At1g60650.1 68414.m06827 glycine-rich RNA-binding protein, putat... 35 0.067 At2g18510.1 68415.m02157 pre-mRNA splicing factor, putative simi... 34 0.088 At1g18630.1 68414.m02322 glycine-rich RNA-binding protein, putat... 34 0.088 At4g24270.2 68417.m03484 RNA recognition motif (RRM)-containing ... 34 0.12 At4g24270.1 68417.m03483 RNA recognition motif (RRM)-containing ... 34 0.12 At2g24350.1 68415.m02910 RNA recognition motif (RRM)-containing ... 34 0.12 At1g60900.1 68414.m06856 U2 snRNP auxiliary factor large subunit... 34 0.12 At1g51510.1 68414.m05797 RNA-binding protein, putative similar t... 34 0.12 At5g50250.1 68418.m06223 31 kDa ribonucleoprotein, chloroplast, ... 33 0.15 At4g34110.1 68417.m04839 polyadenylate-binding protein 2 (PABP2)... 33 0.15 At3g54770.1 68416.m06060 RNA recognition motif (RRM)-containing ... 33 0.15 At3g53460.2 68416.m05901 29 kDa ribonucleoprotein, chloroplast /... 33 0.15 At3g53460.1 68416.m05900 29 kDa ribonucleoprotein, chloroplast /... 33 0.15 At1g71770.1 68414.m08295 polyadenylate-binding protein 5 (PABP5)... 33 0.15 At4g24770.1 68417.m03546 31 kDa ribonucleoprotein, chloroplast, ... 33 0.20 At2g27330.1 68415.m03286 RNA recognition motif (RRM)-containing ... 33 0.20 At1g72800.1 68414.m08416 nuM1-related contains similarity with n... 33 0.20 At5g04600.1 68418.m00460 RNA recognition motif (RRM)-containing ... 33 0.27 At4g39260.4 68417.m05560 glycine-rich RNA-binding protein 8 (GRP... 33 0.27 At3g54230.1 68416.m05994 zinc finger protein-related / D111/G-pa... 32 0.36 At3g20930.1 68416.m02645 RNA recognition motif (RRM)-containing ... 32 0.36 At3g10400.1 68416.m01246 RNA recognition motif (RRM)-containing ... 32 0.36 At5g47320.1 68418.m05833 30S ribosomal protein S19, mitochondria... 32 0.47 At4g13850.2 68417.m02146 glycine-rich RNA-binding protein (GRP2)... 32 0.47 At4g13850.1 68417.m02145 glycine-rich RNA-binding protein (GRP2)... 32 0.47 At1g54080.1 68414.m06162 oligouridylate-binding protein, putativ... 32 0.47 At5g06210.1 68418.m00693 RNA-binding protein, putative contains ... 31 0.62 At4g13860.1 68417.m02147 glycine-rich RNA-binding protein, putat... 31 0.62 At1g49600.1 68414.m05561 RNA-binding protein 47 (RBP47), putativ... 31 0.62 At5g46840.1 68418.m05771 RNA recognition motif (RRM)-containing ... 31 0.82 At1g11650.2 68414.m01337 RNA-binding protein 45 (RBP45), putativ... 31 0.82 At1g11650.1 68414.m01336 RNA-binding protein 45 (RBP45), putativ... 31 0.82 At4g20030.1 68417.m02932 RNA recognition motif (RRM)-containing ... 31 1.1 At3g46020.1 68416.m04979 RNA-binding protein, putative similar t... 31 1.1 At1g17370.1 68414.m02118 oligouridylate-binding protein, putativ... 31 1.1 At5g54900.1 68418.m06838 RNA-binding protein 45 (RBP45), putativ... 30 1.4 At3g14100.1 68416.m01782 oligouridylate-binding protein, putativ... 30 1.4 At3g11400.1 68416.m01390 eukaryotic translation initiation facto... 30 1.4 At1g47500.1 68414.m05272 RNA-binding protein 47 (RBP47), putativ... 30 1.4 At5g54580.1 68418.m06794 RNA recognition motif (RRM)-containing ... 30 1.9 At3g63450.1 68416.m07144 RNA recognition motif (RRM)-containing ... 30 1.9 At2g39260.1 68415.m04821 MIF4G domain-containing protein similar... 30 1.9 At2g21440.1 68415.m02551 RNA recognition motif (RRM)-containing ... 30 1.9 At4g35785.2 68417.m05083 transformer serine/arginine-rich ribonu... 29 2.5 At4g35785.1 68417.m05082 transformer serine/arginine-rich ribonu... 29 2.5 At3g51950.1 68416.m05698 zinc finger (CCCH-type) family protein ... 29 2.5 At3g50670.1 68416.m05542 U1 small nuclear ribonucleoprotein 70 (... 29 2.5 At3g18810.1 68416.m02389 protein kinase family protein contains ... 29 2.5 At2g21690.1 68415.m02580 RNA-binding protein, putative similar t... 29 2.5 At1g60200.1 68414.m06781 splicing factor PWI domain-containing p... 29 2.5 At1g60000.1 68414.m06759 29 kDa ribonucleoprotein, chloroplast, ... 29 3.3 At5g43960.2 68418.m05378 nuclear transport factor 2 (NTF2) famil... 29 4.4 At5g43960.1 68418.m05379 nuclear transport factor 2 (NTF2) famil... 29 4.4 At5g12440.1 68418.m01462 zinc finger (CCCH-type) family protein ... 29 4.4 At5g06000.1 68418.m00665 eukaryotic translation initiation facto... 29 4.4 At3g30820.1 68416.m03953 hypothetical protein 29 4.4 At5g59860.1 68418.m07506 RNA recognition motif (RRM)-containing ... 28 5.8 At4g27000.1 68417.m03884 RNA-binding protein 45 (RBP45), putativ... 28 5.8 At3g55340.1 68416.m06146 RNA recognition motif (RRM)-containing ... 28 5.8 At2g47390.1 68415.m05915 expressed protein 28 5.8 At5g22830.1 68418.m02669 magnesium transporter CorA-like family ... 28 7.7 At4g36690.3 68417.m05206 U2 snRNP auxiliary factor large subunit... 28 7.7 At4g36690.2 68417.m05207 U2 snRNP auxiliary factor large subunit... 28 7.7 At4g36690.1 68417.m05205 U2 snRNP auxiliary factor large subunit... 28 7.7 At1g16610.2 68414.m01990 arginine/serine-rich protein, putative ... 28 7.7 At1g16610.1 68414.m01989 arginine/serine-rich protein, putative ... 28 7.7 At1g03457.2 68414.m00327 RNA-binding protein, putative similar t... 28 7.7 >At3g13224.2 68416.m01658 RNA recognition motif (RRM)-containing protein contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 358 Score = 70.5 bits (165), Expect = 1e-12 Identities = 39/95 (41%), Positives = 56/95 (58%), Gaps = 11/95 (11%) Frame = +1 Query: 256 HFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKVDPKKA--K 429 HFG YGEI + D +TG+ RGF FI F P +DKV+ H IN K+V+ K+ K Sbjct: 38 HFGKYGEITDSVIMRDRHTGQPRGFGFITFADPSVVDKVI-EDTHVINGKQVEIKRTIPK 96 Query: 430 ARHG---------KIFVGGLSSEISDDEIRNFFSE 507 G KIFVGG+ S +++DE+++FF++ Sbjct: 97 GAGGNQSKDIKTKKIFVGGIPSTVTEDELKDFFAK 131 Score = 44.0 bits (99), Expect = 1e-04 Identities = 22/65 (33%), Positives = 35/65 (53%), Gaps = 6/65 (9%) Frame = +1 Query: 259 FGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAG------EHTINNKKVDPK 420 F YG + V D T RSRGF F++F + E +D++++ G + + KK +PK Sbjct: 129 FAKYGNVVEHQVIRDHETNRSRGFGFVIFDSEEVVDELLSKGNMIDMADTQVEIKKAEPK 188 Query: 421 KAKAR 435 K+ R Sbjct: 189 KSLNR 193 Score = 41.1 bits (92), Expect = 8e-04 Identities = 20/56 (35%), Positives = 36/56 (64%), Gaps = 1/56 (1%) Frame = +3 Query: 510 GTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLL-KTPKRTIGGKEVDVKRATPK 674 G ++E ++ D N+ +GF F+ F+SE+VV++LL K + +V++K+A PK Sbjct: 133 GNVVEHQVIRDHETNRSRGFGFVIFDSEEVVDELLSKGNMIDMADTQVEIKKAEPK 188 Score = 38.7 bits (86), Expect = 0.004 Identities = 20/55 (36%), Positives = 31/55 (56%) Frame = +3 Query: 510 GTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPKRTIGGKEVDVKRATPK 674 G I + + D+ Q +GF FITF VV+ +++ I GK+V++KR PK Sbjct: 43 GEITDSVIMRDRHTGQPRGFGFITFADPSVVDKVIE-DTHVINGKQVEIKRTIPK 96 >At3g13224.1 68416.m01657 RNA recognition motif (RRM)-containing protein contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 231 Score = 70.5 bits (165), Expect = 1e-12 Identities = 39/95 (41%), Positives = 56/95 (58%), Gaps = 11/95 (11%) Frame = +1 Query: 256 HFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKVDPKKA--K 429 HFG YGEI + D +TG+ RGF FI F P +DKV+ H IN K+V+ K+ K Sbjct: 38 HFGKYGEITDSVIMRDRHTGQPRGFGFITFADPSVVDKVI-EDTHVINGKQVEIKRTIPK 96 Query: 430 ARHG---------KIFVGGLSSEISDDEIRNFFSE 507 G KIFVGG+ S +++DE+++FF++ Sbjct: 97 GAGGNQSKDIKTKKIFVGGIPSTVTEDELKDFFAK 131 Score = 40.3 bits (90), Expect = 0.001 Identities = 16/42 (38%), Positives = 25/42 (59%) Frame = +1 Query: 259 FGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAG 384 F YG + V D T RSRGF F++F + E +D++++ G Sbjct: 129 FAKYGNVVEHQVIRDHETNRSRGFGFVIFDSEEVVDELLSKG 170 Score = 38.7 bits (86), Expect = 0.004 Identities = 20/55 (36%), Positives = 31/55 (56%) Frame = +3 Query: 510 GTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPKRTIGGKEVDVKRATPK 674 G I + + D+ Q +GF FITF VV+ +++ I GK+V++KR PK Sbjct: 43 GEITDSVIMRDRHTGQPRGFGFITFADPSVVDKVIE-DTHVINGKQVEIKRTIPK 96 Score = 34.3 bits (75), Expect = 0.088 Identities = 14/35 (40%), Positives = 25/35 (71%) Frame = +3 Query: 510 GTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLL 614 G ++E ++ D N+ +GF F+ F+SE+VV++LL Sbjct: 133 GNVVEHQVIRDHETNRSRGFGFVIFDSEEVVDELL 167 >At5g40490.1 68418.m04910 RNA recognition motif (RRM)-containing protein ribonucleoprotein, Xenopus laevis, PIR:S40778; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 423 Score = 63.3 bits (147), Expect = 2e-10 Identities = 35/93 (37%), Positives = 48/93 (51%), Gaps = 9/93 (9%) Frame = +1 Query: 256 HFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKVDPKKAKAR 435 HFG YGEI + D TG+ RGF F+ + +DKV+ H I K+V+ K+ R Sbjct: 61 HFGKYGEITDSVIMKDRKTGQPRGFGFVTYADSSVVDKVI-QDNHIIIGKQVEIKRTIPR 119 Query: 436 HG---------KIFVGGLSSEISDDEIRNFFSE 507 KIFVGG+ S + DDE + FF + Sbjct: 120 GSMSSNDFKTKKIFVGGIPSSVDDDEFKEFFMQ 152 Score = 45.6 bits (103), Expect = 4e-05 Identities = 19/60 (31%), Positives = 38/60 (63%), Gaps = 1/60 (1%) Frame = +1 Query: 259 FGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEH-TINNKKVDPKKAKAR 435 F +GE++ + D +TGRSRGF F+ +++ + +D ++A G ++ +V+ KKA+ + Sbjct: 150 FMQFGELKEHQIMRDHSTGRSRGFGFVTYESEDMVDHLLAKGNRIELSGTQVEIKKAEPK 209 Score = 41.9 bits (94), Expect = 4e-04 Identities = 20/56 (35%), Positives = 35/56 (62%), Gaps = 1/56 (1%) Frame = +3 Query: 510 GTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPKR-TIGGKEVDVKRATPK 674 G + E ++ D + + +GF F+T+ESE +V+ LL R + G +V++K+A PK Sbjct: 154 GELKEHQIMRDHSTGRSRGFGFVTYESEDMVDHLLAKGNRIELSGTQVEIKKAEPK 209 Score = 35.1 bits (77), Expect = 0.050 Identities = 17/55 (30%), Positives = 31/55 (56%) Frame = +3 Query: 510 GTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPKRTIGGKEVDVKRATPK 674 G I + + D+ Q +GF F+T+ VV+ +++ I GK+V++KR P+ Sbjct: 66 GEITDSVIMKDRKTGQPRGFGFVTYADSSVVDKVIQ-DNHIIIGKQVEIKRTIPR 119 Score = 29.1 bits (62), Expect = 3.3 Identities = 18/50 (36%), Positives = 26/50 (52%) Frame = +2 Query: 98 QDITTDNQLNGNAENGGGDSQDHNSAEAPGRDDDRKLFVGGLSWETTDKE 247 +D D + + + E+ SQ H+ G D K+FVGGL+ ETT E Sbjct: 11 EDEIHDPKPSEDIEDDDDKSQPHSGG---GVDSAGKIFVGGLARETTSAE 57 >At1g17640.1 68414.m02183 RNA recognition motif (RRM)-containing protein similar to GB:L02953 from [Xenopus laevis] (Nucleic Acids Res. 21, 999-1006 (1993)); contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 369 Score = 59.3 bits (137), Expect = 3e-09 Identities = 34/94 (36%), Positives = 52/94 (55%), Gaps = 12/94 (12%) Frame = +1 Query: 256 HFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKVDPK----- 420 +FG +GE+ + TD TG RGF F+ F +KV+ +H I+++KVD K Sbjct: 85 YFGKFGEVVDSVIMTDRITGNPRGFGFVTFADSAVAEKVLEE-DHVIDDRKVDLKRTLPR 143 Query: 421 -------KAKARHGKIFVGGLSSEISDDEIRNFF 501 KA ++ KIFVGGL + +DE++N+F Sbjct: 144 GDKDTDIKAVSKTRKIFVGGLPPLLEEDELKNYF 177 Score = 52.4 bits (120), Expect = 3e-07 Identities = 22/61 (36%), Positives = 41/61 (67%), Gaps = 1/61 (1%) Frame = +1 Query: 256 HFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGE-HTINNKKVDPKKAKA 432 +F YG+I + D +TGRSRGF F+ F+ +S+D++ + G+ H + +K+V+ K+A+ Sbjct: 176 YFCVYGDIIEHQIMYDHHTGRSRGFGFVTFQTEDSVDRLFSDGKVHELGDKQVEIKRAEP 235 Query: 433 R 435 + Sbjct: 236 K 236 Score = 44.8 bits (101), Expect = 6e-05 Identities = 21/56 (37%), Positives = 35/56 (62%), Gaps = 1/56 (1%) Frame = +3 Query: 510 GTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK-RTIGGKEVDVKRATPK 674 G I+E ++ +D + +GF F+TF++E V+ L K +G K+V++KRA PK Sbjct: 181 GDIIEHQIMYDHHTGRSRGFGFVTFQTEDSVDRLFSDGKVHELGDKQVEIKRAEPK 236 Score = 33.1 bits (72), Expect = 0.20 Identities = 21/49 (42%), Positives = 27/49 (55%), Gaps = 5/49 (10%) Frame = +2 Query: 107 TTDNQLNGNA--ENGG---GDSQDHNSAEAPGRDDDRKLFVGGLSWETT 238 T D++ NG A + GG S DH + + KLFVGG+SWETT Sbjct: 31 TFDDRRNGGAAVDTGGIQMKHSVDHRHSSS-SMSSPGKLFVGGVSWETT 78 Score = 32.7 bits (71), Expect = 0.27 Identities = 16/57 (28%), Positives = 29/57 (50%) Frame = +3 Query: 510 GTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPKRTIGGKEVDVKRATPKPD 680 G +++ + D+ +GF F+TF V +L+ I ++VD+KR P+ D Sbjct: 90 GEVVDSVIMTDRITGNPRGFGFVTFADSAVAEKVLE-EDHVIDDRKVDLKRTLPRGD 145 >At4g14300.1 68417.m02203 heterogeneous nuclear ribonucleoprotein, putative / hnRNP, putative Length = 411 Score = 56.4 bits (130), Expect = 2e-08 Identities = 36/107 (33%), Positives = 53/107 (49%), Gaps = 25/107 (23%) Frame = +1 Query: 256 HFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKVDPKKAKAR 435 HF YGE+ V D TGR RGF F++F P +D+V+ +H+I+ ++VD K+A +R Sbjct: 25 HFTNYGEVSQAIVMRDKLTGRPRGFGFVIFSDPSVLDRVLQE-KHSIDTREVDVKRAMSR 83 Query: 436 H-------------------------GKIFVGGLSSEISDDEIRNFF 501 KIFVGGL ++D+E R +F Sbjct: 84 EEQQVSGRTGNLNTSRSSGGDAYNKTKKIFVGGLPPTLTDEEFRQYF 130 Score = 50.8 bits (116), Expect = 9e-07 Identities = 21/55 (38%), Positives = 36/55 (65%) Frame = +3 Query: 510 GTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPKRTIGGKEVDVKRATPK 674 G + +V + +D+ N+ +GF F++F+SE V+ +L + GK+V+VKRA PK Sbjct: 134 GPVTDVAIMYDQATNRPRGFGFVSFDSEDAVDSVLHKTFHDLSGKQVEVKRALPK 188 Score = 46.8 bits (106), Expect = 2e-05 Identities = 21/70 (30%), Positives = 37/70 (52%) Frame = +1 Query: 256 HFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKVDPKKAKAR 435 +F YG + + + D T R RGF F+ F + +++D V+ H ++ K+V+ K+A + Sbjct: 129 YFEVYGPVTDVAIMYDQATNRPRGFGFVSFDSEDAVDSVLHKTFHDLSGKQVEVKRALPK 188 Query: 436 HGKIFVGGLS 465 GG S Sbjct: 189 DANPGGGGRS 198 Score = 33.9 bits (74), Expect = 0.12 Identities = 18/57 (31%), Positives = 32/57 (56%) Frame = +3 Query: 510 GTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPKRTIGGKEVDVKRATPKPD 680 G + + + DK + +GF F+ F V++ +L+ K +I +EVDVKRA + + Sbjct: 30 GEVSQAIVMRDKLTGRPRGFGFVIFSDPSVLDRVLQE-KHSIDTREVDVKRAMSREE 85 Score = 33.1 bits (72), Expect = 0.20 Identities = 13/20 (65%), Positives = 16/20 (80%) Frame = +2 Query: 194 DDRKLFVGGLSWETTDKELR 253 D KLFVGG+SWET + +LR Sbjct: 4 DQGKLFVGGISWETDEDKLR 23 Score = 29.9 bits (64), Expect = 1.9 Identities = 11/22 (50%), Positives = 17/22 (77%) Frame = +1 Query: 439 GKIFVGGLSSEISDDEIRNFFS 504 GK+FVGG+S E +D++R F+ Sbjct: 6 GKLFVGGISWETDEDKLREHFT 27 >At4g26650.1 68417.m03840 RNA recognition motif (RRM)-containing protein contains Pfam profile: PF00076 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Length = 455 Score = 53.2 bits (122), Expect = 2e-07 Identities = 38/112 (33%), Positives = 55/112 (49%), Gaps = 28/112 (25%) Frame = +1 Query: 256 HFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKVDPKKAKAR 435 +FG YG++ + D TGR+RGF FIVF P ++V+ +H I+ + V+ KKA R Sbjct: 34 YFGKYGDLVEAVIMRDRTTGRARGFGFIVFADPSVAERVI-MDKHIIDGRTVEAKKAVPR 92 Query: 436 -------------------HG---------KIFVGGLSSEISDDEIRNFFSE 507 HG KIFVGGL S I++ E +N+F + Sbjct: 93 DDQQVLKRHASPMHLISPSHGGNGGGARTKKIFVGGLPSSITEAEFKNYFDQ 144 Score = 50.8 bits (116), Expect = 9e-07 Identities = 24/57 (42%), Positives = 33/57 (57%) Frame = +1 Query: 256 HFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKVDPKKA 426 +F +G I + V D NT R RGF FI F + ES+D V+ H +N K V+ K+A Sbjct: 141 YFDQFGTIADVVVMYDHNTQRPRGFGFITFDSEESVDMVLHKTFHELNGKMVEVKRA 197 Score = 49.6 bits (113), Expect = 2e-06 Identities = 24/55 (43%), Positives = 35/55 (63%) Frame = +3 Query: 510 GTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPKRTIGGKEVDVKRATPK 674 GTI +V + +D + +GF FITF+SE+ V+ +L + GK V+VKRA PK Sbjct: 146 GTIADVVVMYDHNTQRPRGFGFITFDSEESVDMVLHKTFHELNGKMVEVKRAVPK 200 Score = 36.7 bits (81), Expect = 0.017 Identities = 18/57 (31%), Positives = 30/57 (52%) Frame = +3 Query: 510 GTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPKRTIGGKEVDVKRATPKPD 680 G ++E + D+T + +GF FI F V ++ K I G+ V+ K+A P+ D Sbjct: 39 GDLVEAVIMRDRTTGRARGFGFIVFADPSVAERVI-MDKHIIDGRTVEAKKAVPRDD 94 Score = 28.7 bits (61), Expect = 4.4 Identities = 9/17 (52%), Positives = 15/17 (88%) Frame = +2 Query: 203 KLFVGGLSWETTDKELR 253 KLF+GG+SW+T ++ L+ Sbjct: 16 KLFIGGISWDTDEERLQ 32 >At2g33410.1 68415.m04095 heterogeneous nuclear ribonucleoprotein, putative / hnRNP, putative Length = 404 Score = 52.8 bits (121), Expect = 2e-07 Identities = 24/60 (40%), Positives = 37/60 (61%) Frame = +1 Query: 256 HFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKVDPKKAKAR 435 +F +GE+ + V + TGR RGF F+ F P ID+V+ +H I+N+ VD K+A +R Sbjct: 25 YFSNFGEVLQVTVMREKATGRPRGFGFVAFSDPAVIDRVL-QDKHHIDNRDVDVKRAMSR 83 Score = 46.8 bits (106), Expect = 2e-05 Identities = 20/57 (35%), Positives = 32/57 (56%) Frame = +1 Query: 256 HFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKVDPKKA 426 +F YG + + D T R RGF F+ F + +S+D V+ H +N K+V+ K+A Sbjct: 129 YFETYGPVSDAVIMIDQTTQRPRGFGFVSFDSEDSVDLVLHKTFHDLNGKQVEVKRA 185 Score = 44.4 bits (100), Expect = 8e-05 Identities = 20/55 (36%), Positives = 34/55 (61%) Frame = +3 Query: 510 GTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPKRTIGGKEVDVKRATPK 674 G + + + D+T + +GF F++F+SE V+ +L + GK+V+VKRA PK Sbjct: 134 GPVSDAVIMIDQTTQRPRGFGFVSFDSEDSVDLVLHKTFHDLNGKQVEVKRALPK 188 Score = 36.7 bits (81), Expect = 0.017 Identities = 18/57 (31%), Positives = 33/57 (57%) Frame = +3 Query: 510 GTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPKRTIGGKEVDVKRATPKPD 680 G +L+V + +K + +GF F+ F V++ +L+ K I ++VDVKRA + + Sbjct: 30 GEVLQVTVMREKATGRPRGFGFVAFSDPAVIDRVLQD-KHHIDNRDVDVKRAMSREE 85 Score = 30.3 bits (65), Expect = 1.4 Identities = 11/20 (55%), Positives = 15/20 (75%) Frame = +2 Query: 194 DDRKLFVGGLSWETTDKELR 253 D KLF+GG+SW+T + LR Sbjct: 4 DQGKLFIGGISWDTDENLLR 23 >At5g55550.3 68418.m06922 RNA recognition motif (RRM)-containing protein similar to DAZ associated protein 1 [Homo sapiens] GI:8671754; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 460 Score = 52.0 bits (119), Expect = 4e-07 Identities = 37/109 (33%), Positives = 55/109 (50%), Gaps = 25/109 (22%) Frame = +1 Query: 256 HFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKVDPKKAKAR 435 +F YG++ + D TGR+RGF FIVF P ++V+ +H I+ + V+ KKA R Sbjct: 25 YFSNYGDVVEAVIMRDRATGRARGFGFIVFADPCVSERVI-MDKHIIDGRTVEAKKAVPR 83 Query: 436 -------------------HG------KIFVGGLSSEISDDEIRNFFSE 507 HG KIFVGGL S I+++E +N+F + Sbjct: 84 DDQQVLKRHASPIHLMSPVHGGGGRTKKIFVGGLPSSITEEEFKNYFDQ 132 Score = 49.2 bits (112), Expect = 3e-06 Identities = 22/57 (38%), Positives = 34/57 (59%) Frame = +1 Query: 256 HFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKVDPKKA 426 +F +G I + V D NT R RGF FI F + +++D+V+ H +N K V+ K+A Sbjct: 129 YFDQFGTIADVVVMYDHNTQRPRGFGFITFDSDDAVDRVLHKTFHELNGKLVEVKRA 185 Score = 48.4 bits (110), Expect = 5e-06 Identities = 23/55 (41%), Positives = 34/55 (61%) Frame = +3 Query: 510 GTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPKRTIGGKEVDVKRATPK 674 GTI +V + +D + +GF FITF+S+ V+ +L + GK V+VKRA PK Sbjct: 134 GTIADVVVMYDHNTQRPRGFGFITFDSDDAVDRVLHKTFHELNGKLVEVKRAVPK 188 Score = 30.3 bits (65), Expect = 1.4 Identities = 10/17 (58%), Positives = 15/17 (88%) Frame = +2 Query: 203 KLFVGGLSWETTDKELR 253 KLF+GG+SW+T ++ LR Sbjct: 7 KLFIGGISWDTDEERLR 23 Score = 29.5 bits (63), Expect = 2.5 Identities = 9/22 (40%), Positives = 18/22 (81%) Frame = +1 Query: 439 GKIFVGGLSSEISDDEIRNFFS 504 GK+F+GG+S + ++ +R++FS Sbjct: 6 GKLFIGGISWDTDEERLRDYFS 27 >At5g55550.2 68418.m06921 RNA recognition motif (RRM)-containing protein similar to DAZ associated protein 1 [Homo sapiens] GI:8671754; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 460 Score = 52.0 bits (119), Expect = 4e-07 Identities = 37/109 (33%), Positives = 55/109 (50%), Gaps = 25/109 (22%) Frame = +1 Query: 256 HFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKVDPKKAKAR 435 +F YG++ + D TGR+RGF FIVF P ++V+ +H I+ + V+ KKA R Sbjct: 25 YFSNYGDVVEAVIMRDRATGRARGFGFIVFADPCVSERVI-MDKHIIDGRTVEAKKAVPR 83 Query: 436 -------------------HG------KIFVGGLSSEISDDEIRNFFSE 507 HG KIFVGGL S I+++E +N+F + Sbjct: 84 DDQQVLKRHASPIHLMSPVHGGGGRTKKIFVGGLPSSITEEEFKNYFDQ 132 Score = 49.2 bits (112), Expect = 3e-06 Identities = 22/57 (38%), Positives = 34/57 (59%) Frame = +1 Query: 256 HFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKVDPKKA 426 +F +G I + V D NT R RGF FI F + +++D+V+ H +N K V+ K+A Sbjct: 129 YFDQFGTIADVVVMYDHNTQRPRGFGFITFDSDDAVDRVLHKTFHELNGKLVEVKRA 185 Score = 48.4 bits (110), Expect = 5e-06 Identities = 23/55 (41%), Positives = 34/55 (61%) Frame = +3 Query: 510 GTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPKRTIGGKEVDVKRATPK 674 GTI +V + +D + +GF FITF+S+ V+ +L + GK V+VKRA PK Sbjct: 134 GTIADVVVMYDHNTQRPRGFGFITFDSDDAVDRVLHKTFHELNGKLVEVKRAVPK 188 Score = 30.3 bits (65), Expect = 1.4 Identities = 10/17 (58%), Positives = 15/17 (88%) Frame = +2 Query: 203 KLFVGGLSWETTDKELR 253 KLF+GG+SW+T ++ LR Sbjct: 7 KLFIGGISWDTDEERLR 23 Score = 29.5 bits (63), Expect = 2.5 Identities = 9/22 (40%), Positives = 18/22 (81%) Frame = +1 Query: 439 GKIFVGGLSSEISDDEIRNFFS 504 GK+F+GG+S + ++ +R++FS Sbjct: 6 GKLFIGGISWDTDEERLRDYFS 27 >At5g55550.1 68418.m06920 RNA recognition motif (RRM)-containing protein similar to DAZ associated protein 1 [Homo sapiens] GI:8671754; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 448 Score = 52.0 bits (119), Expect = 4e-07 Identities = 37/109 (33%), Positives = 55/109 (50%), Gaps = 25/109 (22%) Frame = +1 Query: 256 HFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKVDPKKAKAR 435 +F YG++ + D TGR+RGF FIVF P ++V+ +H I+ + V+ KKA R Sbjct: 25 YFSNYGDVVEAVIMRDRATGRARGFGFIVFADPCVSERVI-MDKHIIDGRTVEAKKAVPR 83 Query: 436 -------------------HG------KIFVGGLSSEISDDEIRNFFSE 507 HG KIFVGGL S I+++E +N+F + Sbjct: 84 DDQQVLKRHASPIHLMSPVHGGGGRTKKIFVGGLPSSITEEEFKNYFDQ 132 Score = 49.2 bits (112), Expect = 3e-06 Identities = 22/57 (38%), Positives = 34/57 (59%) Frame = +1 Query: 256 HFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKVDPKKA 426 +F +G I + V D NT R RGF FI F + +++D+V+ H +N K V+ K+A Sbjct: 129 YFDQFGTIADVVVMYDHNTQRPRGFGFITFDSDDAVDRVLHKTFHELNGKLVEVKRA 185 Score = 48.4 bits (110), Expect = 5e-06 Identities = 23/55 (41%), Positives = 34/55 (61%) Frame = +3 Query: 510 GTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPKRTIGGKEVDVKRATPK 674 GTI +V + +D + +GF FITF+S+ V+ +L + GK V+VKRA PK Sbjct: 134 GTIADVVVMYDHNTQRPRGFGFITFDSDDAVDRVLHKTFHELNGKLVEVKRAVPK 188 Score = 30.3 bits (65), Expect = 1.4 Identities = 10/17 (58%), Positives = 15/17 (88%) Frame = +2 Query: 203 KLFVGGLSWETTDKELR 253 KLF+GG+SW+T ++ LR Sbjct: 7 KLFIGGISWDTDEERLR 23 Score = 29.5 bits (63), Expect = 2.5 Identities = 9/22 (40%), Positives = 18/22 (81%) Frame = +1 Query: 439 GKIFVGGLSSEISDDEIRNFFS 504 GK+F+GG+S + ++ +R++FS Sbjct: 6 GKLFIGGISWDTDEERLRDYFS 27 >At5g47620.2 68418.m05879 heterogeneous nuclear ribonucleoprotein, putative / hnRNP, putative Length = 431 Score = 50.8 bits (116), Expect = 9e-07 Identities = 33/105 (31%), Positives = 54/105 (51%), Gaps = 21/105 (20%) Frame = +1 Query: 256 HFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKVDPKKAKAR 435 +F ++GE+ + D TGR+RGF F+VF P ++V+ +H I+ K V+ KKA R Sbjct: 25 YFHSFGEVLEAVIMKDRATGRARGFGFVVFADPNVAERVVLL-KHIIDGKIVEAKKAVPR 83 Query: 436 HG---------------------KIFVGGLSSEISDDEIRNFFSE 507 KIFVGGL+S +++ E + +F++ Sbjct: 84 DDHVVFNKSNSSLQGSPGPSNSKKIFVGGLASSVTEAEFKKYFAQ 128 Score = 46.4 bits (105), Expect = 2e-05 Identities = 22/57 (38%), Positives = 32/57 (56%) Frame = +1 Query: 256 HFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKVDPKKA 426 +F +G I + V D T R RGF FI + + E++DKV+ H +N K V+ K A Sbjct: 125 YFAQFGMITDVVVMYDHRTQRPRGFGFISYDSEEAVDKVLQKTFHELNGKMVEVKLA 181 Score = 43.6 bits (98), Expect = 1e-04 Identities = 20/55 (36%), Positives = 34/55 (61%) Frame = +3 Query: 510 GTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPKRTIGGKEVDVKRATPK 674 G I +V + +D + +GF FI+++SE+ V+ +L+ + GK V+VK A PK Sbjct: 130 GMITDVVVMYDHRTQRPRGFGFISYDSEEAVDKVLQKTFHELNGKMVEVKLAVPK 184 Score = 35.5 bits (78), Expect = 0.038 Identities = 18/57 (31%), Positives = 29/57 (50%) Frame = +3 Query: 510 GTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPKRTIGGKEVDVKRATPKPD 680 G +LE + D+ + +GF F+ F V ++ K I GK V+ K+A P+ D Sbjct: 30 GEVLEAVIMKDRATGRARGFGFVVFADPNVAERVVLL-KHIIDGKIVEAKKAVPRDD 85 Score = 31.5 bits (68), Expect = 0.62 Identities = 11/17 (64%), Positives = 15/17 (88%) Frame = +2 Query: 203 KLFVGGLSWETTDKELR 253 KLF+GG+SWET++ LR Sbjct: 7 KLFIGGISWETSEDRLR 23 Score = 29.9 bits (64), Expect = 1.9 Identities = 10/20 (50%), Positives = 17/20 (85%) Frame = +1 Query: 442 KIFVGGLSSEISDDEIRNFF 501 K+F+GG+S E S+D +R++F Sbjct: 7 KLFIGGISWETSEDRLRDYF 26 Score = 27.9 bits (59), Expect = 7.7 Identities = 10/25 (40%), Positives = 17/25 (68%) Frame = +2 Query: 179 APGRDDDRKLFVGGLSWETTDKELR 253 +PG + +K+FVGGL+ T+ E + Sbjct: 99 SPGPSNSKKIFVGGLASSVTEAEFK 123 >At5g47620.1 68418.m05878 heterogeneous nuclear ribonucleoprotein, putative / hnRNP, putative Length = 431 Score = 50.8 bits (116), Expect = 9e-07 Identities = 33/105 (31%), Positives = 54/105 (51%), Gaps = 21/105 (20%) Frame = +1 Query: 256 HFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKVDPKKAKAR 435 +F ++GE+ + D TGR+RGF F+VF P ++V+ +H I+ K V+ KKA R Sbjct: 25 YFHSFGEVLEAVIMKDRATGRARGFGFVVFADPNVAERVVLL-KHIIDGKIVEAKKAVPR 83 Query: 436 HG---------------------KIFVGGLSSEISDDEIRNFFSE 507 KIFVGGL+S +++ E + +F++ Sbjct: 84 DDHVVFNKSNSSLQGSPGPSNSKKIFVGGLASSVTEAEFKKYFAQ 128 Score = 46.4 bits (105), Expect = 2e-05 Identities = 22/57 (38%), Positives = 32/57 (56%) Frame = +1 Query: 256 HFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKVDPKKA 426 +F +G I + V D T R RGF FI + + E++DKV+ H +N K V+ K A Sbjct: 125 YFAQFGMITDVVVMYDHRTQRPRGFGFISYDSEEAVDKVLQKTFHELNGKMVEVKLA 181 Score = 43.6 bits (98), Expect = 1e-04 Identities = 20/55 (36%), Positives = 34/55 (61%) Frame = +3 Query: 510 GTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPKRTIGGKEVDVKRATPK 674 G I +V + +D + +GF FI+++SE+ V+ +L+ + GK V+VK A PK Sbjct: 130 GMITDVVVMYDHRTQRPRGFGFISYDSEEAVDKVLQKTFHELNGKMVEVKLAVPK 184 Score = 35.5 bits (78), Expect = 0.038 Identities = 18/57 (31%), Positives = 29/57 (50%) Frame = +3 Query: 510 GTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPKRTIGGKEVDVKRATPKPD 680 G +LE + D+ + +GF F+ F V ++ K I GK V+ K+A P+ D Sbjct: 30 GEVLEAVIMKDRATGRARGFGFVVFADPNVAERVVLL-KHIIDGKIVEAKKAVPRDD 85 Score = 31.5 bits (68), Expect = 0.62 Identities = 11/17 (64%), Positives = 15/17 (88%) Frame = +2 Query: 203 KLFVGGLSWETTDKELR 253 KLF+GG+SWET++ LR Sbjct: 7 KLFIGGISWETSEDRLR 23 Score = 29.9 bits (64), Expect = 1.9 Identities = 10/20 (50%), Positives = 17/20 (85%) Frame = +1 Query: 442 KIFVGGLSSEISDDEIRNFF 501 K+F+GG+S E S+D +R++F Sbjct: 7 KLFIGGISWETSEDRLRDYF 26 Score = 27.9 bits (59), Expect = 7.7 Identities = 10/25 (40%), Positives = 17/25 (68%) Frame = +2 Query: 179 APGRDDDRKLFVGGLSWETTDKELR 253 +PG + +K+FVGGL+ T+ E + Sbjct: 99 SPGPSNSKKIFVGGLASSVTEAEFK 123 >At3g07810.2 68416.m00956 heterogeneous nuclear ribonucleoprotein, putative / hnRNP, putative contains Pfam profile: PF00076 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Length = 495 Score = 48.4 bits (110), Expect = 5e-06 Identities = 30/107 (28%), Positives = 53/107 (49%), Gaps = 23/107 (21%) Frame = +1 Query: 256 HFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKVDPKKA--- 426 +F ++GE+ + D TGR+RGF F+VF P ++ +++ +H I+ + V+ KKA Sbjct: 25 YFSSFGEVIEAVILKDRTTGRARGFGFVVFADP-AVAEIVITEKHNIDGRLVEAKKAVPR 83 Query: 427 --------------------KARHGKIFVGGLSSEISDDEIRNFFSE 507 R KIFVGGL S +++ + + +F + Sbjct: 84 DDQNMVNRSNSSSIQGSPGGPGRTRKIFVGGLPSSVTESDFKTYFEQ 130 Score = 47.2 bits (107), Expect = 1e-05 Identities = 22/55 (40%), Positives = 33/55 (60%) Frame = +3 Query: 510 GTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPKRTIGGKEVDVKRATPK 674 GT +V + +D + +GF FIT++SE+ V +L + GK V+VKRA PK Sbjct: 132 GTTTDVVVMYDHNTQRPRGFGFITYDSEEAVEKVLLKTFHELNGKMVEVKRAVPK 186 Score = 39.9 bits (89), Expect = 0.002 Identities = 18/57 (31%), Positives = 34/57 (59%) Frame = +3 Query: 510 GTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPKRTIGGKEVDVKRATPKPD 680 G ++E + D+T + +GF F+ F ++ V +++ T K I G+ V+ K+A P+ D Sbjct: 30 GEVIEAVILKDRTTGRARGFGFVVF-ADPAVAEIVITEKHNIDGRLVEAKKAVPRDD 85 Score = 31.9 bits (69), Expect = 0.47 Identities = 10/22 (45%), Positives = 18/22 (81%) Frame = +2 Query: 188 RDDDRKLFVGGLSWETTDKELR 253 + D+ KLF+GG+SW+T ++ L+ Sbjct: 2 QSDNGKLFIGGISWDTNEERLK 23 Score = 29.1 bits (62), Expect = 3.3 Identities = 16/45 (35%), Positives = 20/45 (44%) Frame = +2 Query: 131 NAENGGGDSQDHNSAEAPGRDDDRKLFVGGLSWETTDKELRVILE 265 N N S S PGR RK+FVGGL T+ + + E Sbjct: 87 NMVNRSNSSSIQGSPGGPGRT--RKIFVGGLPSSVTESDFKTYFE 129 Score = 28.7 bits (61), Expect = 4.4 Identities = 8/23 (34%), Positives = 19/23 (82%) Frame = +1 Query: 436 HGKIFVGGLSSEISDDEIRNFFS 504 +GK+F+GG+S + +++ ++ +FS Sbjct: 5 NGKLFIGGISWDTNEERLKEYFS 27 >At3g07810.1 68416.m00955 heterogeneous nuclear ribonucleoprotein, putative / hnRNP, putative contains Pfam profile: PF00076 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Length = 494 Score = 48.4 bits (110), Expect = 5e-06 Identities = 30/107 (28%), Positives = 53/107 (49%), Gaps = 23/107 (21%) Frame = +1 Query: 256 HFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKVDPKKA--- 426 +F ++GE+ + D TGR+RGF F+VF P ++ +++ +H I+ + V+ KKA Sbjct: 25 YFSSFGEVIEAVILKDRTTGRARGFGFVVFADP-AVAEIVITEKHNIDGRLVEAKKAVPR 83 Query: 427 --------------------KARHGKIFVGGLSSEISDDEIRNFFSE 507 R KIFVGGL S +++ + + +F + Sbjct: 84 DDQNMVNRSNSSSIQGSPGGPGRTRKIFVGGLPSSVTESDFKTYFEQ 130 Score = 47.2 bits (107), Expect = 1e-05 Identities = 22/55 (40%), Positives = 33/55 (60%) Frame = +3 Query: 510 GTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPKRTIGGKEVDVKRATPK 674 GT +V + +D + +GF FIT++SE+ V +L + GK V+VKRA PK Sbjct: 132 GTTTDVVVMYDHNTQRPRGFGFITYDSEEAVEKVLLKTFHELNGKMVEVKRAVPK 186 Score = 39.9 bits (89), Expect = 0.002 Identities = 18/57 (31%), Positives = 34/57 (59%) Frame = +3 Query: 510 GTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPKRTIGGKEVDVKRATPKPD 680 G ++E + D+T + +GF F+ F ++ V +++ T K I G+ V+ K+A P+ D Sbjct: 30 GEVIEAVILKDRTTGRARGFGFVVF-ADPAVAEIVITEKHNIDGRLVEAKKAVPRDD 85 Score = 31.9 bits (69), Expect = 0.47 Identities = 10/22 (45%), Positives = 18/22 (81%) Frame = +2 Query: 188 RDDDRKLFVGGLSWETTDKELR 253 + D+ KLF+GG+SW+T ++ L+ Sbjct: 2 QSDNGKLFIGGISWDTNEERLK 23 Score = 29.1 bits (62), Expect = 3.3 Identities = 16/45 (35%), Positives = 20/45 (44%) Frame = +2 Query: 131 NAENGGGDSQDHNSAEAPGRDDDRKLFVGGLSWETTDKELRVILE 265 N N S S PGR RK+FVGGL T+ + + E Sbjct: 87 NMVNRSNSSSIQGSPGGPGRT--RKIFVGGLPSSVTESDFKTYFE 129 Score = 28.7 bits (61), Expect = 4.4 Identities = 8/23 (34%), Positives = 19/23 (82%) Frame = +1 Query: 436 HGKIFVGGLSSEISDDEIRNFFS 504 +GK+F+GG+S + +++ ++ +FS Sbjct: 5 NGKLFIGGISWDTNEERLKEYFS 27 >At4g36960.1 68417.m05238 RNA recognition motif (RRM)-containing protein similar to SP|P48809 Heterogeneous nuclear ribonucleoprotein 27C (hnRNP 48) {Drosophila melanogaster}; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM); non-consensus TA donor splice site at exon 6 Length = 379 Score = 47.6 bits (108), Expect = 9e-06 Identities = 27/95 (28%), Positives = 47/95 (49%), Gaps = 9/95 (9%) Frame = +1 Query: 244 GAPCHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKVDPKK 423 G + +G++E V D +TGRSRGF ++ F + E + GEH + N+ ++ K Sbjct: 18 GLKDYMSKFGDLEDCIVMKDRSTGRSRGFGYVTFASAEDAKNAL-KGEHFLGNRILEVKV 76 Query: 424 AKARH---------GKIFVGGLSSEISDDEIRNFF 501 A + +IFV + S +S+ + R+ F Sbjct: 77 ATPKEEMRQPAKKVTRIFVARIPSSVSESDFRSHF 111 Score = 46.4 bits (105), Expect = 2e-05 Identities = 25/57 (43%), Positives = 31/57 (54%) Frame = +3 Query: 510 GTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPKRTIGGKEVDVKRATPKPD 680 G I ++ MP D Q +G FITF S V DL++ +GG V V RATPK D Sbjct: 115 GEITDLYMPKDYNSKQHRGIGFITFSSADSVEDLME-DTHDLGGTTVAVDRATPKED 170 Score = 37.1 bits (82), Expect = 0.012 Identities = 15/40 (37%), Positives = 24/40 (60%) Frame = +1 Query: 256 HFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVM 375 HF YGEI + + D N+ + RG FI F + +S++ +M Sbjct: 110 HFERYGEITDLYMPKDYNSKQHRGIGFITFSSADSVEDLM 149 Score = 33.9 bits (74), Expect = 0.12 Identities = 17/52 (32%), Positives = 25/52 (48%) Frame = +1 Query: 256 HFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKV 411 +FG +G I+ + DP RGF F+ F D+V A H I ++V Sbjct: 259 YFGRFGHIQDAYIPKDPKRSGHRGFGFVTFAENGVADRV-ARRSHEICGQEV 309 Score = 33.5 bits (73), Expect = 0.15 Identities = 19/54 (35%), Positives = 29/54 (53%) Frame = +3 Query: 510 GTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPKRTIGGKEVDVKRATP 671 G I + +P D ++ +GF F+TF +E V D + I G+EV + ATP Sbjct: 264 GHIQDAYIPKDPKRSGHRGFGFVTF-AENGVADRVARRSHEICGQEVAIDSATP 316 Score = 32.3 bits (70), Expect = 0.36 Identities = 15/47 (31%), Positives = 29/47 (61%) Frame = +3 Query: 540 DKTKNQRKGFCFITFESEQVVNDLLKTPKRTIGGKEVDVKRATPKPD 680 D++ + +GF ++TF S + + LK + +G + ++VK ATPK + Sbjct: 37 DRSTGRSRGFGYVTFASAEDAKNALK-GEHFLGNRILEVKVATPKEE 82 >At1g58470.1 68414.m06651 RNA-binding protein (XF41) identical to RNA binding protein GI:18181938 from (Arabidopsis thaliana); contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) domain 15450911 gb AY054536.1 Length = 360 Score = 40.7 bits (91), Expect = 0.001 Identities = 19/55 (34%), Positives = 32/55 (58%) Frame = +3 Query: 510 GTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPKRTIGGKEVDVKRATPK 674 G +V + D N+ +GF F+T++SE V ++++ + K V+VKRA PK Sbjct: 144 GRTTDVVVMHDGVTNRPRGFGFVTYDSEDSVEVVMQSNFHELSDKRVEVKRAIPK 198 Score = 35.1 bits (77), Expect(2) = 2e-05 Identities = 20/61 (32%), Positives = 29/61 (47%) Frame = +1 Query: 256 HFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKVDPKKAKAR 435 +F YG + V + TG+ RGF F+ F + K + H I K VD +KA + Sbjct: 25 YFSRYGAVLEAVVAKEKVTGKPRGFGFVRFANDCDVVKAL-RDTHFILGKPVDVRKAIRK 83 Query: 436 H 438 H Sbjct: 84 H 84 Score = 30.7 bits (66), Expect(2) = 2e-05 Identities = 12/24 (50%), Positives = 19/24 (79%) Frame = +1 Query: 430 ARHGKIFVGGLSSEISDDEIRNFF 501 +R KIFVGGLSS +++E +++F Sbjct: 117 SRTKKIFVGGLSSNTTEEEFKSYF 140 Score = 30.3 bits (65), Expect = 1.4 Identities = 20/56 (35%), Positives = 30/56 (53%), Gaps = 1/56 (1%) Frame = +3 Query: 510 GTILEVEMPFDKTKNQRKGFCFITFESE-QVVNDLLKTPKRTIGGKEVDVKRATPK 674 G +LE + +K + +GF F+ F ++ VV L T I GK VDV++A K Sbjct: 30 GAVLEAVVAKEKVTGKPRGFGFVRFANDCDVVKALRDT--HFILGKPVDVRKAIRK 83 Score = 28.3 bits (60), Expect = 5.8 Identities = 9/21 (42%), Positives = 17/21 (80%) Frame = +1 Query: 442 KIFVGGLSSEISDDEIRNFFS 504 K+FVGG++ E S++ ++ +FS Sbjct: 7 KLFVGGIAKETSEEALKQYFS 27 >At5g47620.3 68418.m05877 heterogeneous nuclear ribonucleoprotein, putative / hnRNP, putative Length = 358 Score = 46.4 bits (105), Expect = 2e-05 Identities = 22/57 (38%), Positives = 32/57 (56%) Frame = +1 Query: 256 HFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKVDPKKA 426 +F +G I + V D T R RGF FI + + E++DKV+ H +N K V+ K A Sbjct: 52 YFAQFGMITDVVVMYDHRTQRPRGFGFISYDSEEAVDKVLQKTFHELNGKMVEVKLA 108 Score = 43.6 bits (98), Expect = 1e-04 Identities = 20/55 (36%), Positives = 34/55 (61%) Frame = +3 Query: 510 GTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPKRTIGGKEVDVKRATPK 674 G I +V + +D + +GF FI+++SE+ V+ +L+ + GK V+VK A PK Sbjct: 57 GMITDVVVMYDHRTQRPRGFGFISYDSEEAVDKVLQKTFHELNGKMVEVKLAVPK 111 Score = 31.1 bits (67), Expect = 0.82 Identities = 14/50 (28%), Positives = 27/50 (54%), Gaps = 3/50 (6%) Frame = +1 Query: 367 KVMAAGEHTINNKK---VDPKKAKARHGKIFVGGLSSEISDDEIRNFFSE 507 K + +H + NK + + KIFVGGL+S +++ E + +F++ Sbjct: 6 KAVPRDDHVVFNKSNSSLQGSPGPSNSKKIFVGGLASSVTEAEFKKYFAQ 55 Score = 27.9 bits (59), Expect = 7.7 Identities = 10/25 (40%), Positives = 17/25 (68%) Frame = +2 Query: 179 APGRDDDRKLFVGGLSWETTDKELR 253 +PG + +K+FVGGL+ T+ E + Sbjct: 26 SPGPSNSKKIFVGGLASSVTEAEFK 50 >At1g76460.1 68414.m08893 RNA recognition motif (RRM)-containing protein low similarity to RRM-containing protein SEB-4 [Xenopus laevis] GI:8895698; contains Pfam profile: PF00076 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Length = 285 Score = 44.8 bits (101), Expect = 6e-05 Identities = 20/53 (37%), Positives = 30/53 (56%) Frame = +1 Query: 256 HFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKVD 414 HF YGEI V D NTGRS+G+ F+ F+ PE+ + A I+ ++ + Sbjct: 43 HFEQYGEILEAVVIADKNTGRSKGYGFVTFRDPEAARRACADPTPIIDGRRAN 95 Score = 30.7 bits (66), Expect = 1.1 Identities = 17/59 (28%), Positives = 26/59 (44%), Gaps = 3/59 (5%) Frame = +3 Query: 510 GTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPKRTIGGKEVDVKRAT---PKP 677 G ILE + DK + KG+ F+TF + P I G+ + A+ P+P Sbjct: 48 GEILEAVVIADKNTGRSKGYGFVTFRDPEAARRACADPTPIIDGRRANCNLASLGRPRP 106 Score = 29.1 bits (62), Expect = 3.3 Identities = 11/17 (64%), Positives = 14/17 (82%) Frame = +2 Query: 203 KLFVGGLSWETTDKELR 253 K+FVGGL+WET + LR Sbjct: 25 KVFVGGLAWETQSETLR 41 >At1g20880.1 68414.m02615 RNA recognition motif (RRM)-containing protein similar to RRM-containing protein SEB-4 [Xenopus laevis] GI:8895698; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM); is the location of EST 197B1T7 , gb|AA597386 Length = 274 Score = 44.4 bits (100), Expect = 8e-05 Identities = 18/35 (51%), Positives = 24/35 (68%) Frame = +1 Query: 256 HFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPES 360 HF YG+I V TD NTGRS+G+ F+ F+ PE+ Sbjct: 43 HFDQYGDILEAVVITDKNTGRSKGYGFVTFRDPEA 77 Score = 29.9 bits (64), Expect = 1.9 Identities = 15/53 (28%), Positives = 23/53 (43%) Frame = +3 Query: 510 GTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPKRTIGGKEVDVKRAT 668 G ILE + DK + KG+ F+TF + P I G+ + A+ Sbjct: 48 GDILEAVVITDKNTGRSKGYGFVTFRDPEAARRACVDPTPIIDGRRANCNLAS 100 Score = 29.1 bits (62), Expect = 3.3 Identities = 11/17 (64%), Positives = 14/17 (82%) Frame = +2 Query: 203 KLFVGGLSWETTDKELR 253 K+FVGGL+WET + LR Sbjct: 25 KVFVGGLAWETQSETLR 41 >At2g19380.1 68415.m02260 RNA recognition motif (RRM)-containing protein similar to UBP1 interacting protein 1a [Arabidopsis thaliana] GI:19574236; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM); contains Pfam profile PF00096: Zinc finger, C2H2 type Length = 613 Score = 44.0 bits (99), Expect = 1e-04 Identities = 21/62 (33%), Positives = 34/62 (54%) Frame = +1 Query: 259 FGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKVDPKKAKARH 438 F +YGEIE +V D +TGR +G+ F++FK + + + E + N+ V A + Sbjct: 428 FESYGEIEECSVVMDKDTGRGKGYGFVMFKTRKGAREALKRPEKRMYNRIVVCNLASEKP 487 Query: 439 GK 444 GK Sbjct: 488 GK 489 >At3g15010.2 68416.m01899 RNA recognition motif (RRM)-containing protein similar to UBP1 interacting protein 1a [Arabidopsis thaliana] GI:19574236; contains Pfam profile: PF00076 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Length = 404 Score = 43.2 bits (97), Expect = 2e-04 Identities = 22/57 (38%), Positives = 31/57 (54%) Frame = +1 Query: 256 HFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKVDPKKA 426 HF AYG++E + D TG+SRGFA V+K E +A I+ K ++ K A Sbjct: 186 HFMAYGDVEEGPLGFDKVTGKSRGFALFVYKTAEGAQAALADPVKVIDGKHLNCKLA 242 Score = 35.9 bits (79), Expect = 0.029 Identities = 22/81 (27%), Positives = 40/81 (49%) Frame = +1 Query: 259 FGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKVDPKKAKARH 438 F +YG++E V D TG+S+G+ F+ F +D + A + +KK+D + + Sbjct: 95 FSSYGDLEEAIVILDKVTGKSKGYGFVTFM---HVDGALLALKEP--SKKIDGRVTVTQL 149 Query: 439 GKIFVGGLSSEISDDEIRNFF 501 G S+I+D +R + Sbjct: 150 AASGNQGTGSQIADISMRKIY 170 Score = 31.1 bits (67), Expect = 0.82 Identities = 14/52 (26%), Positives = 25/52 (48%) Frame = +3 Query: 510 GTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPKRTIGGKEVDVKRA 665 G + E + FDK + +GF +++ + L P + I GK ++ K A Sbjct: 191 GDVEEGPLGFDKVTGKSRGFALFVYKTAEGAQAALADPVKVIDGKHLNCKLA 242 >At3g15010.1 68416.m01898 RNA recognition motif (RRM)-containing protein similar to UBP1 interacting protein 1a [Arabidopsis thaliana] GI:19574236; contains Pfam profile: PF00076 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Length = 404 Score = 43.2 bits (97), Expect = 2e-04 Identities = 22/57 (38%), Positives = 31/57 (54%) Frame = +1 Query: 256 HFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKVDPKKA 426 HF AYG++E + D TG+SRGFA V+K E +A I+ K ++ K A Sbjct: 186 HFMAYGDVEEGPLGFDKVTGKSRGFALFVYKTAEGAQAALADPVKVIDGKHLNCKLA 242 Score = 35.9 bits (79), Expect = 0.029 Identities = 22/81 (27%), Positives = 40/81 (49%) Frame = +1 Query: 259 FGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKVDPKKAKARH 438 F +YG++E V D TG+S+G+ F+ F +D + A + +KK+D + + Sbjct: 95 FSSYGDLEEAIVILDKVTGKSKGYGFVTFM---HVDGALLALKEP--SKKIDGRVTVTQL 149 Query: 439 GKIFVGGLSSEISDDEIRNFF 501 G S+I+D +R + Sbjct: 150 AASGNQGTGSQIADISMRKIY 170 Score = 31.1 bits (67), Expect = 0.82 Identities = 14/52 (26%), Positives = 25/52 (48%) Frame = +3 Query: 510 GTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPKRTIGGKEVDVKRA 665 G + E + FDK + +GF +++ + L P + I GK ++ K A Sbjct: 191 GDVEEGPLGFDKVTGKSRGFALFVYKTAEGAQAALADPVKVIDGKHLNCKLA 242 >At1g74230.1 68414.m08597 glycine-rich RNA-binding protein similar to RNA-binding protein GB:S46286 from [Nicotiana sylvestris] Length = 289 Score = 42.7 bits (96), Expect = 3e-04 Identities = 19/59 (32%), Positives = 28/59 (47%) Frame = +1 Query: 259 FGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKVDPKKAKAR 435 F YGE+ + D TGRSRGFAF+ F + E M ++ +++ A R Sbjct: 54 FSKYGEVVDAKIIVDRETGRSRGFAFVTFTSTEEASNAMQLDGQDLHGRRIRVNYATER 112 Score = 33.1 bits (72), Expect = 0.20 Identities = 12/55 (21%), Positives = 31/55 (56%) Frame = +3 Query: 510 GTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPKRTIGGKEVDVKRATPK 674 G +++ ++ D+ + +GF F+TF S + ++ ++ + + G+ + V AT + Sbjct: 58 GEVVDAKIIVDRETGRSRGFAFVTFTSTEEASNAMQLDGQDLHGRRIRVNYATER 112 >At5g53720.1 68418.m06676 RNA recognition motif (RRM)-containing protein contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 100 Score = 41.5 bits (93), Expect = 6e-04 Identities = 22/61 (36%), Positives = 31/61 (50%) Frame = +1 Query: 244 GAPCHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKVDPKK 423 G +F +GEI V D T RS+GF F+ F+ ES + HTI+ + V+ K Sbjct: 24 GLISYFERFGEIVYAKVVCDGATQRSKGFGFVTFREVESATRACENPNHTIDGRTVNCKL 83 Query: 424 A 426 A Sbjct: 84 A 84 Score = 32.7 bits (71), Expect = 0.27 Identities = 16/52 (30%), Positives = 25/52 (48%) Frame = +3 Query: 510 GTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPKRTIGGKEVDVKRA 665 G I+ ++ D + KGF F+TF + + P TI G+ V+ K A Sbjct: 33 GEIVYAKVVCDGATQRSKGFGFVTFREVESATRACENPNHTIDGRTVNCKLA 84 >At1g78260.2 68414.m09119 RNA recognition motif (RRM)-containing protein similar to RNA recognition motif-containing protein SEB-4 GI:8895698 from [Xenopus laevis]; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 271 Score = 41.5 bits (93), Expect = 6e-04 Identities = 17/53 (32%), Positives = 31/53 (58%) Frame = +1 Query: 256 HFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKVD 414 +F +GEI + TD NTG+S+G+ F+ F+ +S + +A I+ +K + Sbjct: 36 YFEQFGEILEAVIITDKNTGKSKGYGFVTFRESDSATRAVADPNPVIDGRKAN 88 Score = 31.1 bits (67), Expect = 0.82 Identities = 17/59 (28%), Positives = 27/59 (45%), Gaps = 3/59 (5%) Frame = +3 Query: 510 GTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPKRTIGGKEVDVKRAT---PKP 677 G ILE + DK + KG+ F+TF + P I G++ + A+ P+P Sbjct: 41 GEILEAVIITDKNTGKSKGYGFVTFRESDSATRAVADPNPVIDGRKANCNIASFGRPRP 99 Score = 29.9 bits (64), Expect = 1.9 Identities = 12/21 (57%), Positives = 15/21 (71%) Frame = +2 Query: 203 KLFVGGLSWETTDKELRVILE 265 K+FVGGL+WET E+R E Sbjct: 18 KVFVGGLAWETPTDEMRRYFE 38 Score = 29.1 bits (62), Expect = 3.3 Identities = 11/22 (50%), Positives = 16/22 (72%) Frame = +1 Query: 442 KIFVGGLSSEISDDEIRNFFSE 507 K+FVGGL+ E DE+R +F + Sbjct: 18 KVFVGGLAWETPTDEMRRYFEQ 39 >At1g78260.1 68414.m09120 RNA recognition motif (RRM)-containing protein similar to RNA recognition motif-containing protein SEB-4 GI:8895698 from [Xenopus laevis]; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 287 Score = 41.5 bits (93), Expect = 6e-04 Identities = 17/53 (32%), Positives = 31/53 (58%) Frame = +1 Query: 256 HFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKVD 414 +F +GEI + TD NTG+S+G+ F+ F+ +S + +A I+ +K + Sbjct: 36 YFEQFGEILEAVIITDKNTGKSKGYGFVTFRESDSATRAVADPNPVIDGRKAN 88 Score = 31.1 bits (67), Expect = 0.82 Identities = 17/59 (28%), Positives = 27/59 (45%), Gaps = 3/59 (5%) Frame = +3 Query: 510 GTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPKRTIGGKEVDVKRAT---PKP 677 G ILE + DK + KG+ F+TF + P I G++ + A+ P+P Sbjct: 41 GEILEAVIITDKNTGKSKGYGFVTFRESDSATRAVADPNPVIDGRKANCNIASFGRPRP 99 Score = 29.9 bits (64), Expect = 1.9 Identities = 12/21 (57%), Positives = 15/21 (71%) Frame = +2 Query: 203 KLFVGGLSWETTDKELRVILE 265 K+FVGGL+WET E+R E Sbjct: 18 KVFVGGLAWETPTDEMRRYFE 38 Score = 29.1 bits (62), Expect = 3.3 Identities = 11/22 (50%), Positives = 16/22 (72%) Frame = +1 Query: 442 KIFVGGLSSEISDDEIRNFFSE 507 K+FVGGL+ E DE+R +F + Sbjct: 18 KVFVGGLAWETPTDEMRRYFEQ 39 >At1g49760.1 68414.m05580 polyadenylate-binding protein, putative / PABP, putative similar to poly(A)-binding protein GB:AAF66825 GI:7673359 from [Nicotiana tabacum] Length = 671 Score = 41.5 bits (93), Expect = 6e-04 Identities = 27/95 (28%), Positives = 45/95 (47%), Gaps = 12/95 (12%) Frame = +1 Query: 259 FGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVM-AAGEHTINNKKV-------- 411 F A+G I S V DP+ G+S+G+ F+ + E+ + +N+K+V Sbjct: 153 FSAFGPILSCKVAVDPS-GQSKGYGFVQYDTDEAAQGAIDKLNGMLLNDKQVYVGPFVHK 211 Query: 412 ---DPKKAKARHGKIFVGGLSSEISDDEIRNFFSE 507 DP K + ++V LS +SD+E+ F E Sbjct: 212 LQRDPSGEKVKFTNVYVKNLSESLSDEELNKVFGE 246 Score = 34.7 bits (76), Expect = 0.067 Identities = 16/40 (40%), Positives = 21/40 (52%) Frame = +1 Query: 256 HFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVM 375 HF +G I S V DP+ G SRG F+ F PE + + Sbjct: 346 HFAPFGTITSCKVMRDPS-GVSRGSGFVAFSTPEEATRAI 384 Score = 32.7 bits (71), Expect = 0.27 Identities = 21/90 (23%), Positives = 37/90 (41%), Gaps = 8/90 (8%) Frame = +1 Query: 259 FGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVM-AAGEHTINNKKV-------D 414 F G++ S+ V D T RS G+ ++ + P+ + + +N + + D Sbjct: 65 FTQAGQVVSVRVCRDMTTRRSLGYGYVNYATPQDASRALNELNFMALNGRAIRVMYSVRD 124 Query: 415 PKKAKARHGKIFVGGLSSEISDDEIRNFFS 504 P K+ G IF+ L I + FS Sbjct: 125 PSLRKSGVGNIFIKNLDKSIDHKALHETFS 154 >At1g07350.1 68414.m00783 transformer serine/arginine-rich ribonucleoprotein, putative similar to GB:Y09506 from [Nicotiana tabacum] (Plant Mol. Biol. 35 (3), 261-269 (1997)) Length = 382 Score = 40.3 bits (90), Expect = 0.001 Identities = 18/64 (28%), Positives = 36/64 (56%), Gaps = 1/64 (1%) Frame = +1 Query: 256 HFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTI-NNKKVDPKKAKA 432 HF G++ +++ DP T SRGF FI K+ ++ + + +H++ + + +KA+ Sbjct: 94 HFAKEGKVTDVHLVLDPWTRESRGFGFISMKSVGDANRCIRSLDHSVLQGRVITVEKARR 153 Query: 433 RHGK 444 R G+ Sbjct: 154 RRGR 157 >At3g19130.1 68416.m02429 RNA-binding protein, putative similar to RNA Binding Protein 47 [Nicotiana plumbaginifolia] GI:9663769, DNA binding protein ACBF GB:AAC49850 from [Nicotiana tabacum]; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 435 Score = 31.1 bits (67), Expect(2) = 0.001 Identities = 12/26 (46%), Positives = 17/26 (65%) Frame = +1 Query: 268 YGEIESINVKTDPNTGRSRGFAFIVF 345 Y ++S V D NTGRS+G+ F+ F Sbjct: 226 YPSVKSAKVVIDSNTGRSKGYGFVRF 251 Score = 28.3 bits (60), Expect(2) = 0.001 Identities = 15/52 (28%), Positives = 26/52 (50%), Gaps = 2/52 (3%) Frame = +1 Query: 358 SIDKVMAAGEHTINNKKV--DPKKAKARHGKIFVGGLSSEISDDEIRNFFSE 507 S V+ AG H N ++ + IFVGG+ ++ D+++R FS+ Sbjct: 292 SSQAVILAGGHGSNGSMGYGSQSDGESTNATIFVGGIDPDVIDEDLRQPFSQ 343 >At2g46780.1 68415.m05836 RNA recognition motif (RRM)-containing protein contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 304 Score = 39.9 bits (89), Expect = 0.002 Identities = 17/35 (48%), Positives = 23/35 (65%) Frame = +1 Query: 256 HFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPES 360 +F +GEI V TD NTGRS+G+ F+ FK E+ Sbjct: 41 YFEQFGEIVEAVVITDKNTGRSKGYGFVTFKEAEA 75 >At2g22100.1 68415.m02625 RNA recognition motif (RRM)-containing protein similar to UBP1 interacting protein 1a [Arabidopsis thaliana] GI:19574236; contains Pfam profile: PF00076 RNA recognition motif (aka RRM, RBD, or RNP domain) Length = 382 Score = 39.9 bits (89), Expect = 0.002 Identities = 18/51 (35%), Positives = 28/51 (54%) Frame = +1 Query: 259 FGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKV 411 F YGEI +V D +TGR++GF F++FK + + E + N+ V Sbjct: 183 FEVYGEITECSVVMDKDTGRAKGFGFVLFKTRKGARAALKNPEKRMYNRTV 233 Score = 32.7 bits (71), Expect = 0.27 Identities = 16/54 (29%), Positives = 26/54 (48%) Frame = +3 Query: 510 GTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPKRTIGGKEVDVKRATP 671 G I E + DK + KGF F+ F++ + LK P++ + + V A P Sbjct: 187 GEITECSVVMDKDTGRAKGFGFVLFKTRKGARAALKNPEKRMYNRTVSCLPARP 240 Score = 29.1 bits (62), Expect = 3.3 Identities = 13/31 (41%), Positives = 18/31 (58%), Gaps = 1/31 (3%) Frame = +2 Query: 176 EAPGRDDD-RKLFVGGLSWETTDKELRVILE 265 E+ RD R +FV GL W+TT + L+ E Sbjct: 154 ESADRDSSQRNIFVRGLGWDTTHENLKAAFE 184 >At2g22090.2 68415.m02624 UBP1 interacting protein 1a (UBA1a) nearly identical to UBP1 interacting protein 1a [Arabidopsis thaliana] GI:19574236; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM); based on cDNA of partial mRNA for UBP1 interacting protein 1a (uba1a) GI:19574235 Length = 347 Score = 39.1 bits (87), Expect = 0.003 Identities = 17/49 (34%), Positives = 27/49 (55%) Frame = +1 Query: 259 FGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNK 405 F YGEIE V D TG+++GF F++FK + + + + I N+ Sbjct: 124 FEGYGEIEECTVVIDKATGKAKGFGFVMFKTRKGAKEALKEPKKRILNR 172 Score = 33.9 bits (74), Expect = 0.12 Identities = 17/56 (30%), Positives = 28/56 (50%) Frame = +3 Query: 510 GTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPKRTIGGKEVDVKRATPKP 677 G I E + DK + KGF F+ F++ + + LK PK+ I + + A+ P Sbjct: 128 GEIEECTVVIDKATGKAKGFGFVMFKTRKGAKEALKEPKKRILNRTATCQLASMGP 183 Score = 29.5 bits (63), Expect = 2.5 Identities = 16/31 (51%), Positives = 19/31 (61%), Gaps = 1/31 (3%) Frame = +2 Query: 176 EAPGRD-DDRKLFVGGLSWETTDKELRVILE 265 EA RD RK+FV GL WETT + L + E Sbjct: 95 EAADRDVTHRKIFVYGLPWETTRETLVGVFE 125 >At2g22090.1 68415.m02623 UBP1 interacting protein 1a (UBA1a) nearly identical to UBP1 interacting protein 1a [Arabidopsis thaliana] GI:19574236; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM); based on cDNA of partial mRNA for UBP1 interacting protein 1a (uba1a) GI:19574235 Length = 343 Score = 39.1 bits (87), Expect = 0.003 Identities = 17/49 (34%), Positives = 27/49 (55%) Frame = +1 Query: 259 FGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNK 405 F YGEIE V D TG+++GF F++FK + + + + I N+ Sbjct: 124 FEGYGEIEECTVVIDKATGKAKGFGFVMFKTRKGAKEALKEPKKRILNR 172 Score = 33.9 bits (74), Expect = 0.12 Identities = 17/56 (30%), Positives = 28/56 (50%) Frame = +3 Query: 510 GTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPKRTIGGKEVDVKRATPKP 677 G I E + DK + KGF F+ F++ + + LK PK+ I + + A+ P Sbjct: 128 GEIEECTVVIDKATGKAKGFGFVMFKTRKGAKEALKEPKKRILNRTATCQLASMGP 183 Score = 29.5 bits (63), Expect = 2.5 Identities = 16/31 (51%), Positives = 19/31 (61%), Gaps = 1/31 (3%) Frame = +2 Query: 176 EAPGRD-DDRKLFVGGLSWETTDKELRVILE 265 EA RD RK+FV GL WETT + L + E Sbjct: 95 EAADRDVTHRKIFVYGLPWETTRETLVGVFE 125 >At2g21660.2 68415.m02578 glycine-rich RNA-binding protein (GRP7) SP|Q03250 Glycine-rich RNA-binding protein 7 {Arabidopsis thaliana} Length = 159 Score = 39.1 bits (87), Expect = 0.003 Identities = 17/60 (28%), Positives = 32/60 (53%), Gaps = 1/60 (1%) Frame = +1 Query: 259 FGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESI-DKVMAAGEHTINNKKVDPKKAKAR 435 F YG++ + D TGRSRGF F+ FK +++ D + ++ + + +A++R Sbjct: 28 FAQYGDVIDSKIINDRETGRSRGFGFVTFKDEKAMKDAIEGMNGQDLDGRSITVNEAQSR 87 Score = 29.5 bits (63), Expect = 2.5 Identities = 12/53 (22%), Positives = 30/53 (56%), Gaps = 1/53 (1%) Frame = +3 Query: 510 GTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK-RTIGGKEVDVKRA 665 G +++ ++ D+ + +GF F+TF+ E+ + D ++ + + G+ + V A Sbjct: 32 GDVIDSKIINDRETGRSRGFGFVTFKDEKAMKDAIEGMNGQDLDGRSITVNEA 84 >At2g21660.1 68415.m02577 glycine-rich RNA-binding protein (GRP7) SP|Q03250 Glycine-rich RNA-binding protein 7 {Arabidopsis thaliana} Length = 176 Score = 39.1 bits (87), Expect = 0.003 Identities = 17/60 (28%), Positives = 32/60 (53%), Gaps = 1/60 (1%) Frame = +1 Query: 259 FGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESI-DKVMAAGEHTINNKKVDPKKAKAR 435 F YG++ + D TGRSRGF F+ FK +++ D + ++ + + +A++R Sbjct: 28 FAQYGDVIDSKIINDRETGRSRGFGFVTFKDEKAMKDAIEGMNGQDLDGRSITVNEAQSR 87 Score = 29.5 bits (63), Expect = 2.5 Identities = 12/53 (22%), Positives = 30/53 (56%), Gaps = 1/53 (1%) Frame = +3 Query: 510 GTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK-RTIGGKEVDVKRA 665 G +++ ++ D+ + +GF F+TF+ E+ + D ++ + + G+ + V A Sbjct: 32 GDVIDSKIINDRETGRSRGFGFVTFKDEKAMKDAIEGMNGQDLDGRSITVNEA 84 >At5g61030.1 68418.m07659 RNA-binding protein, putative similar to RNA-binding protein from [Solanum tuberosum] GI:15822705, [Nicotiana tabacum] GI:15822703, [Nicotiana sylvestris] GI:624925; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 309 Score = 38.3 bits (85), Expect = 0.005 Identities = 17/41 (41%), Positives = 22/41 (53%) Frame = +1 Query: 259 FGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA 381 F YGE+ V D TGRSRGF F+ F + E+ + A Sbjct: 60 FTKYGEVVDTRVILDRETGRSRGFGFVTFTSSEAASSAIQA 100 Score = 28.3 bits (60), Expect = 5.8 Identities = 13/56 (23%), Positives = 28/56 (50%), Gaps = 1/56 (1%) Frame = +3 Query: 510 GTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKT-PKRTIGGKEVDVKRATPK 674 G +++ + D+ + +GF F+TF S + + ++ R + G+ V V A + Sbjct: 64 GEVVDTRVILDRETGRSRGFGFVTFTSSEAASSAIQALDGRDLHGRVVKVNYANDR 119 >At5g53680.1 68418.m06668 RNA recognition motif (RRM)-containing protein low similarity to RRM-containing protein SEB-4 [Xenopus laevis] GI:8895698; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 169 Score = 38.3 bits (85), Expect = 0.005 Identities = 20/56 (35%), Positives = 28/56 (50%) Frame = +1 Query: 259 FGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKVDPKKA 426 F +GEI +NV D T RS+G+ F+ FK ES + TI + + K A Sbjct: 33 FKRFGEIIHVNVVCDRETDRSQGYGFVTFKDAESATRACKDPNPTIEGRITNCKLA 88 >At4g19610.1 68417.m02881 RNA recognition motif (RRM)-containing protein contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 783 Score = 38.3 bits (85), Expect = 0.005 Identities = 15/40 (37%), Positives = 24/40 (60%) Frame = +1 Query: 256 HFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVM 375 HF +G+I +++ D T RSRG A+I++ PE + M Sbjct: 280 HFSTFGKISEVHLVLDKETKRSRGIAYILYLIPECAARAM 319 >At3g26420.1 68416.m03295 glycine-rich RNA-binding protein similar to RNA-binding protein (RZ-1) GB:BAA12064 [Nicotiana sylvestris]; contains Pfam profile: PF00076 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Length = 245 Score = 38.3 bits (85), Expect = 0.005 Identities = 20/62 (32%), Positives = 32/62 (51%), Gaps = 1/62 (1%) Frame = +1 Query: 259 FGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA-GEHTINNKKVDPKKAKAR 435 F YG + V D +GRSRGF FI F +++D+ +AA ++ + + KA+ Sbjct: 27 FEKYGHLVEAKVVLDKFSGRSRGFGFITFDEKKAMDEAIAAMNGMDLDGRTITVDKAQPH 86 Query: 436 HG 441 G Sbjct: 87 QG 88 Score = 32.7 bits (71), Expect = 0.27 Identities = 14/55 (25%), Positives = 31/55 (56%), Gaps = 1/55 (1%) Frame = +3 Query: 510 GTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK-RTIGGKEVDVKRATP 671 G ++E ++ DK + +GF FITF+ ++ +++ + + G+ + V +A P Sbjct: 31 GHLVEAKVVLDKFSGRSRGFGFITFDEKKAMDEAIAAMNGMDLDGRTITVDKAQP 85 Score = 30.7 bits (66), Expect = 1.1 Identities = 14/37 (37%), Positives = 24/37 (64%), Gaps = 3/37 (8%) Frame = +2 Query: 191 DDDRKLFVGGLSWETTDKELRVILE---HTVK*RVLM 292 D + + F+GGL+W T+D+ LR E H V+ +V++ Sbjct: 4 DPEYRCFIGGLAWTTSDRGLRDAFEKYGHLVEAKVVL 40 >At2g37220.1 68415.m04566 29 kDa ribonucleoprotein, chloroplast, putative / RNA-binding protein cp29, putative similar to SP|Q43349 29 kDa ribonucleoprotein, chloroplast precursor (RNA-binding protein cp29) {Arabidopsis thaliana} Length = 289 Score = 38.3 bits (85), Expect = 0.005 Identities = 16/57 (28%), Positives = 33/57 (57%), Gaps = 1/57 (1%) Frame = +3 Query: 510 GTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKT-PKRTIGGKEVDVKRATPKP 677 G ++E + +D+ + KGF F+T++S Q V + +K+ + G+++ V A +P Sbjct: 228 GKVVEARVIYDRDSGRSKGFGFVTYDSSQEVQNAIKSLDGADLDGRQIRVSEAEARP 284 Score = 34.7 bits (76), Expect(2) = 0.010 Identities = 20/61 (32%), Positives = 31/61 (50%) Frame = +1 Query: 259 FGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKVDPKKAKARH 438 F + G +E + V D TGRSRGF F+ S+ +V AA + N ++D + + Sbjct: 111 FESAGNVEMVEVIYDKITGRSRGFGFVTM---SSVSEVEAAAQQ-FNGYELDGRPLRVNA 166 Query: 439 G 441 G Sbjct: 167 G 167 Score = 31.1 bits (67), Expect = 0.82 Identities = 13/60 (21%), Positives = 33/60 (55%), Gaps = 1/60 (1%) Frame = +1 Query: 259 FGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHT-INNKKVDPKKAKAR 435 F G++ V D ++GRS+GF F+ + + + + + + + ++ +++ +A+AR Sbjct: 224 FSEQGKVVEARVIYDRDSGRSKGFGFVTYDSSQEVQNAIKSLDGADLDGRQIRVSEAEAR 283 Score = 21.8 bits (44), Expect(2) = 0.010 Identities = 8/22 (36%), Positives = 14/22 (63%) Frame = +1 Query: 442 KIFVGGLSSEISDDEIRNFFSE 507 +++VG LS + D + + FSE Sbjct: 205 RVYVGNLSWGVDDMALESLFSE 226 >At1g22330.1 68414.m02793 RNA recognition motif (RRM)-containing protein similar to UBP1 interacting protein 1a [Arabidopsis thaliana] GI:19574236; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 146 Score = 38.3 bits (85), Expect = 0.005 Identities = 16/53 (30%), Positives = 30/53 (56%) Frame = +1 Query: 256 HFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKVD 414 +F +GEI + TD TG+S+G+ F+ F+ +S + +A I+ +K + Sbjct: 36 YFDQFGEILEAVIITDKATGKSKGYGFVTFRDSDSATRAVADPNPVIDGRKAN 88 Score = 31.5 bits (68), Expect = 0.62 Identities = 12/24 (50%), Positives = 17/24 (70%) Frame = +1 Query: 436 HGKIFVGGLSSEISDDEIRNFFSE 507 H K+FVGGL+ E DE+R +F + Sbjct: 16 HTKVFVGGLAWETPTDEMRRYFDQ 39 Score = 31.1 bits (67), Expect = 0.82 Identities = 17/59 (28%), Positives = 27/59 (45%), Gaps = 3/59 (5%) Frame = +3 Query: 510 GTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPKRTIGGKEVDVKRAT---PKP 677 G ILE + DK + KG+ F+TF + P I G++ + A+ P+P Sbjct: 41 GEILEAVIITDKATGKSKGYGFVTFRDSDSATRAVADPNPVIDGRKANCNIASFGRPRP 99 Score = 29.5 bits (63), Expect = 2.5 Identities = 11/17 (64%), Positives = 14/17 (82%) Frame = +2 Query: 203 KLFVGGLSWETTDKELR 253 K+FVGGL+WET E+R Sbjct: 18 KVFVGGLAWETPTDEMR 34 >At3g47120.1 68416.m05116 RNA recognition motif (RRM)-containing protein contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 352 Score = 37.9 bits (84), Expect = 0.007 Identities = 15/34 (44%), Positives = 22/34 (64%) Frame = +1 Query: 259 FGAYGEIESINVKTDPNTGRSRGFAFIVFKAPES 360 F YGEI +N+ D TG+S+GFAF+ ++ S Sbjct: 56 FSQYGEIVDVNLIRDKGTGKSKGFAFLAYEDQRS 89 >At5g64200.2 68418.m08063 arginine/serine-rich splicing factor SC35 contains similarity to splicing factor; contains Pfam profile PF00076: RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Length = 303 Score = 37.5 bits (83), Expect = 0.009 Identities = 23/71 (32%), Positives = 35/71 (49%), Gaps = 8/71 (11%) Frame = +1 Query: 259 FGAYGEIESINVKTDPNTGRSRGFAFIVF-------KAPESID-KVMAAGEHTINNKKVD 414 F YG++ + + D TG SRGFAF+ + KA E +D +V+ E T+ K Sbjct: 36 FAKYGKVVDVFIPRDRRTGDSRGFAFVRYKYKDEAHKAVERLDGRVVDGREITVQFAKYG 95 Query: 415 PKKAKARHGKI 447 P K G++ Sbjct: 96 PNAEKISKGRV 106 >At5g64200.1 68418.m08062 arginine/serine-rich splicing factor SC35 contains similarity to splicing factor; contains Pfam profile PF00076: RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Length = 303 Score = 37.5 bits (83), Expect = 0.009 Identities = 23/71 (32%), Positives = 35/71 (49%), Gaps = 8/71 (11%) Frame = +1 Query: 259 FGAYGEIESINVKTDPNTGRSRGFAFIVF-------KAPESID-KVMAAGEHTINNKKVD 414 F YG++ + + D TG SRGFAF+ + KA E +D +V+ E T+ K Sbjct: 36 FAKYGKVVDVFIPRDRRTGDSRGFAFVRYKYKDEAHKAVERLDGRVVDGREITVQFAKYG 95 Query: 415 PKKAKARHGKI 447 P K G++ Sbjct: 96 PNAEKISKGRV 106 >At4g03110.2 68417.m00421 RNA-binding protein, putative similar to Etr-1 [Danio rerio] GI:7670536, BRUNO-like 6 RNA-binding protein [Homo sapiens] GI:15341327, CUG-BP and ETR-3 like factor 3 [Homo sapiens] GI:12746392; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 439 Score = 37.5 bits (83), Expect = 0.009 Identities = 23/91 (25%), Positives = 45/91 (49%), Gaps = 8/91 (8%) Frame = +1 Query: 259 FGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA--------GEHTINNKKVD 414 F + ++ +N+ D T SRG F++ + E DK++ A G +++ K Sbjct: 38 FQEFAVVDEVNIIKDKITRASRGCCFLLCPSREEADKLVNACHNKKTLPGANSLLQVKYA 97 Query: 415 PKKAKARHGKIFVGGLSSEISDDEIRNFFSE 507 + + K+FVG L +S+ E+++ FS+ Sbjct: 98 DGELERLEHKLFVGMLPKNVSEAEVQSLFSK 128 >At4g03110.1 68417.m00420 RNA-binding protein, putative similar to Etr-1 [Danio rerio] GI:7670536, BRUNO-like 6 RNA-binding protein [Homo sapiens] GI:15341327, CUG-BP and ETR-3 like factor 3 [Homo sapiens] GI:12746392; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 441 Score = 37.5 bits (83), Expect = 0.009 Identities = 23/91 (25%), Positives = 45/91 (49%), Gaps = 8/91 (8%) Frame = +1 Query: 259 FGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA--------GEHTINNKKVD 414 F + ++ +N+ D T SRG F++ + E DK++ A G +++ K Sbjct: 38 FQEFAVVDEVNIIKDKITRASRGCCFLLCPSREEADKLVNACHNKKTLPGANSLLQVKYA 97 Query: 415 PKKAKARHGKIFVGGLSSEISDDEIRNFFSE 507 + + K+FVG L +S+ E+++ FS+ Sbjct: 98 DGELERLEHKLFVGMLPKNVSEAEVQSLFSK 128 >At4g00830.1 68417.m00114 RNA recognition motif (RRM)-containing protein similar to nucleolin protein; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 495 Score = 37.1 bits (82), Expect = 0.012 Identities = 18/80 (22%), Positives = 35/80 (43%) Frame = +1 Query: 271 GEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKVDPKKAKARHGKIF 450 GEI + + D ++G S+G+AF+ FK + K + K ++F Sbjct: 140 GEIFEVRLMKDRDSGDSKGYAFVAFKTKDVAQKAIEELHSKEFKGKTIRCSLSETKNRLF 199 Query: 451 VGGLSSEISDDEIRNFFSEL 510 +G + ++DE R ++ Sbjct: 200 IGNIPKNWTEDEFRKVIEDV 219 Score = 28.7 bits (61), Expect = 4.4 Identities = 12/24 (50%), Positives = 19/24 (79%), Gaps = 1/24 (4%) Frame = +1 Query: 277 IESINVKTDP-NTGRSRGFAFIVF 345 +E+I + DP NT R+RGFAF+++ Sbjct: 223 VENIELIKDPTNTTRNRGFAFVLY 246 >At1g33470.2 68414.m04143 RNA recognition motif (RRM)-containing protein similar to RRM-containing protein SEB-4 [Xenopus laevis] GI:8895698; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 244 Score = 37.1 bits (82), Expect = 0.012 Identities = 16/53 (30%), Positives = 29/53 (54%) Frame = +1 Query: 256 HFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKVD 414 +F +G+I V TD ++GRS+G+ F+ F PE+ K I+ ++ + Sbjct: 26 YFEQFGDIVEAVVITDKSSGRSKGYGFVTFCDPEAAQKACVDPAPVIDGRRAN 78 Score = 28.3 bits (60), Expect = 5.8 Identities = 14/52 (26%), Positives = 23/52 (44%) Frame = +3 Query: 510 GTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPKRTIGGKEVDVKRA 665 G I+E + DK+ + KG+ F+TF + P I G+ + A Sbjct: 31 GDIVEAVVITDKSSGRSKGYGFVTFCDPEAAQKACVDPAPVIDGRRANCNLA 82 Score = 27.9 bits (59), Expect = 7.7 Identities = 12/21 (57%), Positives = 14/21 (66%) Frame = +2 Query: 203 KLFVGGLSWETTDKELRVILE 265 K+FVGGL+WET LR E Sbjct: 8 KVFVGGLAWETHKVSLRNYFE 28 >At1g33470.1 68414.m04142 RNA recognition motif (RRM)-containing protein similar to RRM-containing protein SEB-4 [Xenopus laevis] GI:8895698; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 245 Score = 37.1 bits (82), Expect = 0.012 Identities = 16/53 (30%), Positives = 29/53 (54%) Frame = +1 Query: 256 HFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKVD 414 +F +G+I V TD ++GRS+G+ F+ F PE+ K I+ ++ + Sbjct: 26 YFEQFGDIVEAVVITDKSSGRSKGYGFVTFCDPEAAQKACVDPAPVIDGRRAN 78 Score = 28.3 bits (60), Expect = 5.8 Identities = 14/52 (26%), Positives = 23/52 (44%) Frame = +3 Query: 510 GTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPKRTIGGKEVDVKRA 665 G I+E + DK+ + KG+ F+TF + P I G+ + A Sbjct: 31 GDIVEAVVITDKSSGRSKGYGFVTFCDPEAAQKACVDPAPVIDGRRANCNLA 82 Score = 27.9 bits (59), Expect = 7.7 Identities = 12/21 (57%), Positives = 14/21 (66%) Frame = +2 Query: 203 KLFVGGLSWETTDKELRVILE 265 K+FVGGL+WET LR E Sbjct: 8 KVFVGGLAWETHKVSLRNYFE 28 >At3g52660.1 68416.m05801 RNA recognition motif (RRM)-containing protein heterogeneous nuclear ribonucleoprotein R, Homo sapiens, PIR:T02673; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 471 Score = 36.7 bits (81), Expect = 0.017 Identities = 14/78 (17%), Positives = 41/78 (52%), Gaps = 1/78 (1%) Frame = +1 Query: 262 GAYGEIESINVKTDPNTGRSRGFAFIVFKAPE-SIDKVMAAGEHTINNKKVDPKKAKARH 438 G+ GE+ + + + ++G +G+AF+ F++ + + + + K++ +A+H Sbjct: 113 GSIGEVTEVRIMREKDSGDGKGYAFVTFRSKDLAAEAIDTLNNTDFRGKRIKCSTTQAKH 172 Query: 439 GKIFVGGLSSEISDDEIR 492 ++F+G + + +I+ Sbjct: 173 -RLFLGNVPRNWMESDIK 189 Score = 31.5 bits (68), Expect = 0.62 Identities = 15/49 (30%), Positives = 25/49 (51%), Gaps = 1/49 (2%) Frame = +3 Query: 507 IGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPKRT-IGGKEV 650 IG + EV + +K KG+ F+TF S+ + + + T T GK + Sbjct: 115 IGEVTEVRIMREKDSGDGKGYAFVTFRSKDLAAEAIDTLNNTDFRGKRI 163 >At3g23830.2 68416.m02996 glycine-rich RNA-binding protein, putative similar to Glycine-rich RNA-binding protein 2, mitochondrial precursor (AtGRP2) (Swiss-Prot:Q9SVM8) [Arabidopsis thaliana]; contains Pfam profile: PF00076 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Length = 136 Score = 36.7 bits (81), Expect = 0.017 Identities = 15/39 (38%), Positives = 22/39 (56%) Frame = +1 Query: 259 FGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVM 375 F ++GE+ V D TGRSRGF F+ F +S + + Sbjct: 55 FTSFGEVTEATVIADRETGRSRGFGFVSFSCEDSANNAI 93 Score = 31.1 bits (67), Expect = 0.82 Identities = 19/48 (39%), Positives = 23/48 (47%), Gaps = 2/48 (4%) Frame = +2 Query: 116 NQLNGNAENGGGDSQDHNSAEAPG--RDDDRKLFVGGLSWETTDKELR 253 N+L+G G S + G R KLFVGGLSW T D L+ Sbjct: 5 NKLSGILRQGVSQSSNGPVTSMLGSLRYMSSKLFVGGLSWGTDDSSLK 52 >At3g23830.1 68416.m02995 glycine-rich RNA-binding protein, putative similar to Glycine-rich RNA-binding protein 2, mitochondrial precursor (AtGRP2) (Swiss-Prot:Q9SVM8) [Arabidopsis thaliana]; contains Pfam profile: PF00076 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Length = 136 Score = 36.7 bits (81), Expect = 0.017 Identities = 15/39 (38%), Positives = 22/39 (56%) Frame = +1 Query: 259 FGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVM 375 F ++GE+ V D TGRSRGF F+ F +S + + Sbjct: 55 FTSFGEVTEATVIADRETGRSRGFGFVSFSCEDSANNAI 93 Score = 31.1 bits (67), Expect = 0.82 Identities = 19/48 (39%), Positives = 23/48 (47%), Gaps = 2/48 (4%) Frame = +2 Query: 116 NQLNGNAENGGGDSQDHNSAEAPG--RDDDRKLFVGGLSWETTDKELR 253 N+L+G G S + G R KLFVGGLSW T D L+ Sbjct: 5 NKLSGILRQGVSQSSNGPVTSMLGSLRYMSSKLFVGGLSWGTDDSSLK 52 >At3g18610.1 68416.m02365 nucleolin, putative contains Pfam profile: PF00076 RNA recognition motif Length = 636 Score = 36.7 bits (81), Expect = 0.017 Identities = 15/28 (53%), Positives = 19/28 (67%) Frame = +1 Query: 256 HFGAYGEIESINVKTDPNTGRSRGFAFI 339 HF GE+ ++V TD TG SRGFA+I Sbjct: 502 HFSKCGEVTRVHVPTDRETGASRGFAYI 529 Score = 28.3 bits (60), Expect = 5.8 Identities = 14/54 (25%), Positives = 23/54 (42%) Frame = +1 Query: 346 KAPESIDKVMAAGEHTINNKKVDPKKAKARHGKIFVGGLSSEISDDEIRNFFSE 507 K ++ V A + K + + +F G LS +I+ +I NFF E Sbjct: 353 KKDSDVEMVDAEQKSNAKQPKTPTNQTQGGSKTLFAGNLSYQIARSDIENFFKE 406 >At2g23350.1 68415.m02788 polyadenylate-binding protein, putative / PABP, putative Length = 662 Score = 36.7 bits (81), Expect = 0.017 Identities = 22/55 (40%), Positives = 30/55 (54%) Frame = +1 Query: 259 FGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKVDPKK 423 FG YG I S V D + G+SR F F+ F+ PE + + A +N KK D K+ Sbjct: 245 FGQYGSISSAVVMRDGD-GKSRCFGFVNFENPEDAARAVEA----LNGKKFDDKE 294 >At5g19350.1 68418.m02306 RNA-binding protein 45 (RBP45), putative Length = 425 Score = 36.3 bits (80), Expect = 0.022 Identities = 14/37 (37%), Positives = 21/37 (56%) Frame = +1 Query: 268 YGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMA 378 Y + V TDP+TGRS+G+ F+ F ++ MA Sbjct: 140 YSSVRGAKVVTDPSTGRSKGYGFVKFAEESERNRAMA 176 >At3g16380.1 68416.m02074 polyadenylate-binding protein, putative / PABP, putative similar to polyadenylate-binding protein (poly(A)-binding protein) from {Arabidopsis thaliana} SP|P42731, [Cucumis sativus] GI:7528270, {Homo sapiens} SP|Q13310, {Arabidopsis thaliana} SP|Q05196; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 537 Score = 36.3 bits (80), Expect = 0.022 Identities = 18/39 (46%), Positives = 22/39 (56%) Frame = +1 Query: 259 FGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVM 375 F YG + S+ V D GRSRGF F+ F PE+ K M Sbjct: 222 FSQYGTVSSVVVMRD-GMGRSRGFGFVNFCNPENAKKAM 259 Score = 32.3 bits (70), Expect = 0.36 Identities = 15/29 (51%), Positives = 18/29 (62%) Frame = +1 Query: 259 FGAYGEIESINVKTDPNTGRSRGFAFIVF 345 FG YG+I S V N GRS+GF F+ F Sbjct: 324 FGCYGQIVSAKVMCHEN-GRSKGFGFVCF 351 >At2g37510.1 68415.m04600 RNA-binding protein, putative similar to SP|P10979 Glycine-rich RNA-binding, abscisic acid-inducible protein {Zea mays}; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 142 Score = 36.3 bits (80), Expect = 0.022 Identities = 14/40 (35%), Positives = 24/40 (60%) Frame = +1 Query: 259 FGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMA 378 F ++G++ V TD ++GRS+GF F+ + E +K A Sbjct: 54 FASFGQLVDARVITDRDSGRSKGFGFVTYATIEDAEKAKA 93 >At1g22910.3 68414.m02863 RNA recognition motif (RRM)-containing protein contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM); similar to GB:AAC33496 Length = 347 Score = 36.3 bits (80), Expect = 0.022 Identities = 16/53 (30%), Positives = 27/53 (50%) Frame = +1 Query: 256 HFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKVD 414 HF +GEI V TD +GRS+G+ F+ F+ E+ I+ ++ + Sbjct: 32 HFEQFGEILEAVVITDKASGRSKGYGFVTFREAEAARSACVDATPVIDGRRAN 84 Score = 28.7 bits (61), Expect = 4.4 Identities = 15/60 (25%), Positives = 25/60 (41%) Frame = +3 Query: 489 QKLLQ*IGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPKRTIGGKEVDVKRAT 668 +K + G ILE + DK + KG+ F+TF + I G+ + A+ Sbjct: 30 KKHFEQFGEILEAVVITDKASGRSKGYGFVTFREAEAARSACVDATPVIDGRRANCNLAS 89 >At1g22910.2 68414.m02861 RNA recognition motif (RRM)-containing protein contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM); similar to GB:AAC33496 Length = 242 Score = 36.3 bits (80), Expect = 0.022 Identities = 16/53 (30%), Positives = 27/53 (50%) Frame = +1 Query: 256 HFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKVD 414 HF +GEI V TD +GRS+G+ F+ F+ E+ I+ ++ + Sbjct: 32 HFEQFGEILEAVVITDKASGRSKGYGFVTFREAEAARSACVDATPVIDGRRAN 84 Score = 28.7 bits (61), Expect = 4.4 Identities = 15/60 (25%), Positives = 25/60 (41%) Frame = +3 Query: 489 QKLLQ*IGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPKRTIGGKEVDVKRAT 668 +K + G ILE + DK + KG+ F+TF + I G+ + A+ Sbjct: 30 KKHFEQFGEILEAVVITDKASGRSKGYGFVTFREAEAARSACVDATPVIDGRRANCNLAS 89 >At1g22910.1 68414.m02862 RNA recognition motif (RRM)-containing protein contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM); similar to GB:AAC33496 Length = 249 Score = 36.3 bits (80), Expect = 0.022 Identities = 16/53 (30%), Positives = 27/53 (50%) Frame = +1 Query: 256 HFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKVD 414 HF +GEI V TD +GRS+G+ F+ F+ E+ I+ ++ + Sbjct: 32 HFEQFGEILEAVVITDKASGRSKGYGFVTFREAEAARSACVDATPVIDGRRAN 84 Score = 28.7 bits (61), Expect = 4.4 Identities = 15/60 (25%), Positives = 25/60 (41%) Frame = +3 Query: 489 QKLLQ*IGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPKRTIGGKEVDVKRAT 668 +K + G ILE + DK + KG+ F+TF + I G+ + A+ Sbjct: 30 KKHFEQFGEILEAVVITDKASGRSKGYGFVTFREAEAARSACVDATPVIDGRRANCNLAS 89 >At1g22760.1 68414.m02844 polyadenylate-binding protein 3 (PABP3) Length = 660 Score = 36.3 bits (80), Expect = 0.022 Identities = 31/97 (31%), Positives = 46/97 (47%), Gaps = 14/97 (14%) Frame = +1 Query: 259 FGAYGEIESINVKTDPNTGRSRGFAFIVFKAPES----IDKV--MAAGE------HTINN 402 F ++G I S V D TGRS+G+ F+ F+ ES IDK+ M + H I Sbjct: 156 FSSFGTILSCKVAMDV-TGRSKGYGFVQFEKEESAQAAIDKLNGMLMNDKQVFVGHFIRR 214 Query: 403 KK--VDPKKAKARHGKIFVGGLSSEISDDEIRNFFSE 507 ++ D R ++V L EI +DE+R F + Sbjct: 215 QERARDENTPTPRFTNVYVKNLPKEIGEDELRKTFGK 251 Score = 31.9 bits (69), Expect = 0.47 Identities = 14/33 (42%), Positives = 18/33 (54%) Frame = +1 Query: 259 FGAYGEIESINVKTDPNTGRSRGFAFIVFKAPE 357 F YG + S V +P G SRGF F+ + PE Sbjct: 352 FSEYGNVTSSKVMLNPQ-GMSRGFGFVAYSNPE 383 >At2g41060.1 68415.m05070 RNA recognition motif (RRM)-containing protein similar to UBP1 interacting protein 1a [Arabidopsis thaliana] GI:19574236; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 451 Score = 35.9 bits (79), Expect = 0.029 Identities = 19/56 (33%), Positives = 27/56 (48%) Frame = +1 Query: 259 FGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKVDPKKA 426 F +GEIE + D TGR +GFA V+++ ES K + T + KA Sbjct: 247 FSRFGEIEEGPLGLDKATGRPKGFALFVYRSLESAKKALEEPHKTFEGHVLHCHKA 302 Score = 35.5 bits (78), Expect = 0.038 Identities = 27/101 (26%), Positives = 44/101 (43%), Gaps = 19/101 (18%) Frame = +1 Query: 259 FGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKV--------- 411 F YGEIE D +G+S+G+ FI+FK+ + + I + Sbjct: 148 FKQYGEIEDCKCVVDKVSGQSKGYGFILFKSRSGARNALKQPQKKIGTRMTACQLASIGP 207 Query: 412 ---DPKKAKARH-------GKIFVGGLSSEISDDEIRNFFS 504 +P A A+H KI+V +S++I ++ FFS Sbjct: 208 VQGNPVVAPAQHFNPENVQRKIYVSNVSADIDPQKLLEFFS 248 >At1g47490.2 68414.m05269 RNA-binding protein 47 (RBP47), putative similar to DNA binding protein GI:1899187 from [Nicotiana tabacum] Length = 310 Score = 35.9 bits (79), Expect = 0.029 Identities = 28/92 (30%), Positives = 42/92 (45%), Gaps = 14/92 (15%) Frame = +1 Query: 274 EIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKVDP-----------K 420 EI S+ V + N G S G+ F+ F++ + DKV+ T P + Sbjct: 128 EIVSVKVIRNKNNGLSEGYGFVEFESHDVADKVLREFNGTTMPNTDQPFRLNWASFSTGE 187 Query: 421 KAKARHG---KIFVGGLSSEISDDEIRNFFSE 507 K +G IFVG LS ++SD+ + FSE Sbjct: 188 KRLENNGPDLSIFVGDLSPDVSDNLLHETFSE 219 Score = 30.3 bits (65), Expect = 1.4 Identities = 13/36 (36%), Positives = 19/36 (52%) Frame = +1 Query: 268 YGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVM 375 Y +++ V D NTGRS+G+ F+ F K M Sbjct: 221 YPSVKAAKVVLDANTGRSKGYGFVRFGDENERTKAM 256 >At1g47490.1 68414.m05270 RNA-binding protein 47 (RBP47), putative similar to DNA binding protein GI:1899187 from [Nicotiana tabacum] Length = 432 Score = 35.9 bits (79), Expect = 0.029 Identities = 28/92 (30%), Positives = 42/92 (45%), Gaps = 14/92 (15%) Frame = +1 Query: 274 EIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKVDP-----------K 420 EI S+ V + N G S G+ F+ F++ + DKV+ T P + Sbjct: 128 EIVSVKVIRNKNNGLSEGYGFVEFESHDVADKVLREFNGTTMPNTDQPFRLNWASFSTGE 187 Query: 421 KAKARHG---KIFVGGLSSEISDDEIRNFFSE 507 K +G IFVG LS ++SD+ + FSE Sbjct: 188 KRLENNGPDLSIFVGDLSPDVSDNLLHETFSE 219 Score = 30.3 bits (65), Expect = 1.4 Identities = 13/36 (36%), Positives = 19/36 (52%) Frame = +1 Query: 268 YGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVM 375 Y +++ V D NTGRS+G+ F+ F K M Sbjct: 221 YPSVKAAKVVLDANTGRSKGYGFVRFGDENERTKAM 256 Score = 28.3 bits (60), Expect = 5.8 Identities = 10/21 (47%), Positives = 17/21 (80%) Frame = +1 Query: 445 IFVGGLSSEISDDEIRNFFSE 507 IFVGGL S ++D++++ F+E Sbjct: 306 IFVGGLDSSVTDEDLKQPFNE 326 >At1g01080.1 68414.m00010 33 kDa ribonucleoprotein, chloroplast, putative / RNA-binding protein cp33, putative similar to 33 KDA RIBONUCLEOPROTEIN GB:P19684 from [Nicotiana sylvestris] Length = 293 Score = 35.9 bits (79), Expect = 0.029 Identities = 17/41 (41%), Positives = 23/41 (56%) Frame = +1 Query: 256 HFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMA 378 HF +G I S V D TGR+R FAF+ F + E D ++ Sbjct: 231 HFSKFGTIVSTRVLHDRKTGRNRVFAFLSFTSGEERDAALS 271 Score = 28.7 bits (61), Expect = 4.4 Identities = 13/45 (28%), Positives = 23/45 (51%) Frame = +1 Query: 259 FGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHT 393 F +G + S+ V +P TG SRG ++ + S +A+ + T Sbjct: 128 FQPFGTVISVEVSRNPQTGESRGSGYVTMGSINSAKIAIASLDGT 172 >At3g56860.3 68416.m06325 UBP1 interacting protein 2a (UBA2a) identical to UBP1 interacting protein 2a [Arabidopsis thaliana] GI:19682816; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 478 Score = 35.5 bits (78), Expect = 0.038 Identities = 17/56 (30%), Positives = 29/56 (51%) Frame = +3 Query: 510 GTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPKRTIGGKEVDVKRATPKP 677 G I + + FDK + KG+ FI ++S + LK P++ IG + + A+ P Sbjct: 164 GEIEDCKAVFDKISGKSKGYGFILYKSRSGARNALKQPQKKIGSRMTACQLASKGP 219 Score = 35.5 bits (78), Expect = 0.038 Identities = 18/56 (32%), Positives = 27/56 (48%) Frame = +1 Query: 259 FGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKVDPKKA 426 F +GEIE + D TGR +GF V+K+ ES + + T + +KA Sbjct: 265 FSKFGEIEEGPLGLDKYTGRPKGFCLFVYKSSESAKRALEEPHKTFEGHILHCQKA 320 Score = 32.7 bits (71), Expect = 0.27 Identities = 13/31 (41%), Positives = 20/31 (64%) Frame = +1 Query: 259 FGAYGEIESINVKTDPNTGRSRGFAFIVFKA 351 F YGEIE D +G+S+G+ FI++K+ Sbjct: 160 FKQYGEIEDCKAVFDKISGKSKGYGFILYKS 190 >At3g56860.2 68416.m06324 UBP1 interacting protein 2a (UBA2a) identical to UBP1 interacting protein 2a [Arabidopsis thaliana] GI:19682816; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 478 Score = 35.5 bits (78), Expect = 0.038 Identities = 17/56 (30%), Positives = 29/56 (51%) Frame = +3 Query: 510 GTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPKRTIGGKEVDVKRATPKP 677 G I + + FDK + KG+ FI ++S + LK P++ IG + + A+ P Sbjct: 164 GEIEDCKAVFDKISGKSKGYGFILYKSRSGARNALKQPQKKIGSRMTACQLASKGP 219 Score = 35.5 bits (78), Expect = 0.038 Identities = 18/56 (32%), Positives = 27/56 (48%) Frame = +1 Query: 259 FGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKVDPKKA 426 F +GEIE + D TGR +GF V+K+ ES + + T + +KA Sbjct: 265 FSKFGEIEEGPLGLDKYTGRPKGFCLFVYKSSESAKRALEEPHKTFEGHILHCQKA 320 Score = 32.7 bits (71), Expect = 0.27 Identities = 13/31 (41%), Positives = 20/31 (64%) Frame = +1 Query: 259 FGAYGEIESINVKTDPNTGRSRGFAFIVFKA 351 F YGEIE D +G+S+G+ FI++K+ Sbjct: 160 FKQYGEIEDCKAVFDKISGKSKGYGFILYKS 190 >At3g56860.1 68416.m06323 UBP1 interacting protein 2a (UBA2a) identical to UBP1 interacting protein 2a [Arabidopsis thaliana] GI:19682816; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 478 Score = 35.5 bits (78), Expect = 0.038 Identities = 17/56 (30%), Positives = 29/56 (51%) Frame = +3 Query: 510 GTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPKRTIGGKEVDVKRATPKP 677 G I + + FDK + KG+ FI ++S + LK P++ IG + + A+ P Sbjct: 164 GEIEDCKAVFDKISGKSKGYGFILYKSRSGARNALKQPQKKIGSRMTACQLASKGP 219 Score = 35.5 bits (78), Expect = 0.038 Identities = 18/56 (32%), Positives = 27/56 (48%) Frame = +1 Query: 259 FGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKVDPKKA 426 F +GEIE + D TGR +GF V+K+ ES + + T + +KA Sbjct: 265 FSKFGEIEEGPLGLDKYTGRPKGFCLFVYKSSESAKRALEEPHKTFEGHILHCQKA 320 Score = 32.7 bits (71), Expect = 0.27 Identities = 13/31 (41%), Positives = 20/31 (64%) Frame = +1 Query: 259 FGAYGEIESINVKTDPNTGRSRGFAFIVFKA 351 F YGEIE D +G+S+G+ FI++K+ Sbjct: 160 FKQYGEIEDCKAVFDKISGKSKGYGFILYKS 190 >At1g07350.2 68414.m00784 transformer serine/arginine-rich ribonucleoprotein, putative similar to GB:Y09506 from [Nicotiana tabacum] (Plant Mol. Biol. 35 (3), 261-269 (1997)) Length = 129 Score = 35.5 bits (78), Expect = 0.038 Identities = 15/52 (28%), Positives = 29/52 (55%) Frame = +1 Query: 256 HFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKV 411 HF G++ +++ DP T SRGF FI K+ ++ + + +H++ +V Sbjct: 64 HFAKEGKVTDVHLVLDPWTRESRGFGFISMKSVGDANRCIRSLDHSVLQGRV 115 >At5g04280.1 68418.m00421 glycine-rich RNA-binding protein Length = 310 Score = 35.1 bits (77), Expect = 0.050 Identities = 18/60 (30%), Positives = 31/60 (51%), Gaps = 6/60 (10%) Frame = +1 Query: 259 FGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA------GEHTINNKKVDPK 420 F +G+I + + +TGRSRGF FI F ++D+ + G+ I+ + +PK Sbjct: 27 FSRFGDILDCQIMLERDTGRSRGFGFITFADRRAMDESIREMHGRDFGDRVISVNRAEPK 86 Score = 34.7 bits (76), Expect = 0.067 Identities = 16/56 (28%), Positives = 31/56 (55%), Gaps = 1/56 (1%) Frame = +3 Query: 510 GTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK-RTIGGKEVDVKRATPK 674 G IL+ ++ ++ + +GF FITF + +++ ++ R G + + V RA PK Sbjct: 31 GDILDCQIMLERDTGRSRGFGFITFADRRAMDESIREMHGRDFGDRVISVNRAEPK 86 Score = 28.7 bits (61), Expect = 4.4 Identities = 13/26 (50%), Positives = 19/26 (73%), Gaps = 1/26 (3%) Frame = +1 Query: 430 ARHG-KIFVGGLSSEISDDEIRNFFS 504 A+ G +IFVGGLS E++D ++ FS Sbjct: 3 AKEGSRIFVGGLSPEVTDRDLERAFS 28 >At4g39260.3 68417.m05559 glycine-rich RNA-binding protein 8 (GRP8) (CCR1) SP|Q03251 Glycine-rich RNA-binding protein 8 (CCR1 protein) (GRP8) {Arabidopsis thaliana} isoform contains a non-consensus CG acceptor splice site at intron 2 Length = 92 Score = 35.1 bits (77), Expect = 0.050 Identities = 17/52 (32%), Positives = 27/52 (51%) Frame = +1 Query: 259 FGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKVD 414 F +G++ + D +GRSRGF F+ FK +K M +N K++D Sbjct: 26 FSQFGDVIDSKIINDRESGRSRGFGFVTFKD----EKAMRDAIEEMNGKELD 73 Score = 31.5 bits (68), Expect = 0.62 Identities = 14/55 (25%), Positives = 31/55 (56%) Frame = +3 Query: 489 QKLLQ*IGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPKRTIGGKEVD 653 Q+ G +++ ++ D+ + +GF F+TF+ E+ + D ++ + GKE+D Sbjct: 23 QRTFSQFGDVIDSKIINDRESGRSRGFGFVTFKDEKAMRDAIE----EMNGKELD 73 >At4g39260.2 68417.m05558 glycine-rich RNA-binding protein 8 (GRP8) (CCR1) SP|Q03251 Glycine-rich RNA-binding protein 8 (CCR1 protein) (GRP8) {Arabidopsis thaliana} isoform contains a non-consensus CG acceptor splice site at intron 2 Length = 126 Score = 35.1 bits (77), Expect = 0.050 Identities = 17/52 (32%), Positives = 27/52 (51%) Frame = +1 Query: 259 FGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKVD 414 F +G++ + D +GRSRGF F+ FK +K M +N K++D Sbjct: 26 FSQFGDVIDSKIINDRESGRSRGFGFVTFKD----EKAMRDAIEEMNGKELD 73 Score = 31.5 bits (68), Expect = 0.62 Identities = 14/55 (25%), Positives = 31/55 (56%) Frame = +3 Query: 489 QKLLQ*IGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPKRTIGGKEVD 653 Q+ G +++ ++ D+ + +GF F+TF+ E+ + D ++ + GKE+D Sbjct: 23 QRTFSQFGDVIDSKIINDRESGRSRGFGFVTFKDEKAMRDAIE----EMNGKELD 73 >At4g39260.1 68417.m05557 glycine-rich RNA-binding protein 8 (GRP8) (CCR1) SP|Q03251 Glycine-rich RNA-binding protein 8 (CCR1 protein) (GRP8) {Arabidopsis thaliana} isoform contains a non-consensus CG acceptor splice site at intron 2 Length = 169 Score = 35.1 bits (77), Expect = 0.050 Identities = 17/52 (32%), Positives = 27/52 (51%) Frame = +1 Query: 259 FGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKVD 414 F +G++ + D +GRSRGF F+ FK +K M +N K++D Sbjct: 26 FSQFGDVIDSKIINDRESGRSRGFGFVTFKD----EKAMRDAIEEMNGKELD 73 Score = 31.5 bits (68), Expect = 0.62 Identities = 14/55 (25%), Positives = 31/55 (56%) Frame = +3 Query: 489 QKLLQ*IGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPKRTIGGKEVD 653 Q+ G +++ ++ D+ + +GF F+TF+ E+ + D ++ + GKE+D Sbjct: 23 QRTFSQFGDVIDSKIINDRESGRSRGFGFVTFKDEKAMRDAIE----EMNGKELD 73 >At3g52150.1 68416.m05724 RNA recognition motif (RRM)-containing protein similar to chloroplast RNA-binding protein cp33 [Arabidopsis thaliana] GI:681912; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) domain Length = 253 Score = 35.1 bits (77), Expect = 0.050 Identities = 16/57 (28%), Positives = 28/57 (49%), Gaps = 1/57 (1%) Frame = +1 Query: 259 FGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESID-KVMAAGEHTINNKKVDPKKA 426 F G++ S V P T +S GF F+ F + E ++ ++A + +K+ KA Sbjct: 197 FSEKGKVVSAKVSRVPGTSKSTGFGFVTFSSEEDVEAAIVALNNSLLEGQKIRVNKA 253 Score = 30.3 bits (65), Expect = 1.4 Identities = 13/36 (36%), Positives = 20/36 (55%) Frame = +1 Query: 268 YGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVM 375 +G +E + V D +GRSR F F K+ E + V+ Sbjct: 99 HGAVEKVQVMYDKYSGRSRRFGFATMKSVEDANAVV 134 >At2g44710.1 68415.m05564 RNA recognition motif (RRM)-containing protein Length = 809 Score = 35.1 bits (77), Expect = 0.050 Identities = 19/78 (24%), Positives = 36/78 (46%) Frame = +1 Query: 259 FGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKVDPKKAKARH 438 FG GE+ + + +P T +S+G AF+ F E + + + + N K A + Sbjct: 234 FGHVGEVTEVRILKNPQTKKSKGSAFLRFATVEQAKRAVKELKSPMINGKKCGVTASQDN 293 Query: 439 GKIFVGGLSSEISDDEIR 492 +FVG + + + +R Sbjct: 294 DTLFVGNICKIWTPEALR 311 >At2g16260.1 68415.m01862 glycine-rich RNA-binding protein, putative similar to Glycine-rich RNA-binding protein from {Daucus carota} SP|Q03878, {Sinapis alba} SP|P49311, {Brassica napus} SP|Q05966, {Arabidopsis thaliana} SP|Q03251; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 185 Score = 35.1 bits (77), Expect = 0.050 Identities = 14/35 (40%), Positives = 21/35 (60%) Frame = +1 Query: 259 FGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESI 363 F +GE+ + D TGRS+GF F+ FK +S+ Sbjct: 64 FNEFGEVFDSKIIIDRETGRSKGFRFVTFKDEDSM 98 Score = 30.3 bits (65), Expect = 1.4 Identities = 15/53 (28%), Positives = 29/53 (54%) Frame = +3 Query: 510 GTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPKRTIGGKEVDVKRAT 668 G + + ++ D+ + KGF F+TF+ E D ++T + G+E+D + T Sbjct: 68 GEVFDSKIIIDRETGRSKGFRFVTFKDE----DSMRTAIDRMNGQELDGRNIT 116 >At1g48920.1 68414.m05480 nucleolin, putative similar to nuM1 protein GI:1279562 from [Medicago sativa] Length = 557 Score = 35.1 bits (77), Expect = 0.050 Identities = 13/30 (43%), Positives = 22/30 (73%) Frame = +1 Query: 256 HFGAYGEIESINVKTDPNTGRSRGFAFIVF 345 HF + GEI++++V D +TG S+G A++ F Sbjct: 424 HFSSCGEIKNVSVPIDRDTGNSKGIAYLEF 453 >At1g03457.1 68414.m00326 RNA-binding protein, putative similar to Etr-1 [Danio rerio] GI:7670536, BRUNO-like 6 RNA-binding protein [Homo sapiens] GI:15341327; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 429 Score = 35.1 bits (77), Expect = 0.050 Identities = 26/95 (27%), Positives = 43/95 (45%), Gaps = 12/95 (12%) Frame = +1 Query: 259 FGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKV-----DPKK 423 F + + +N+ + T RG F+ E DKV+ ++ +NKK P + Sbjct: 32 FREFSIVNEVNIIKEKTTRAPRGCCFLTCPTREDADKVI----NSFHNKKTLPGASSPLQ 87 Query: 424 AKARHG-------KIFVGGLSSEISDDEIRNFFSE 507 K G K+FVG L +S+ E+++ FSE Sbjct: 88 VKYADGELERLEHKLFVGMLPKNVSETEVQSLFSE 122 >At5g09880.1 68418.m01142 RNA recognition motif (RRM)-containing protein Length = 527 Score = 34.7 bits (76), Expect = 0.067 Identities = 13/29 (44%), Positives = 19/29 (65%) Frame = +1 Query: 259 FGAYGEIESINVKTDPNTGRSRGFAFIVF 345 F A+G +E + + DP TG+ +GF FI F Sbjct: 285 FEAFGPVELVQLPLDPETGQCKGFGFIQF 313 >At3g52380.1 68416.m05757 33 kDa ribonucleoprotein, chloroplast, putative / RNA-binding protein cp33, putative similar to chloroplast RNA-binding protein (cp33) GB:BAA06523 (Arabidopsis thaliana) (Plant Mol. Biol. 27 (3), 529-539 (1995)); contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 329 Score = 34.7 bits (76), Expect = 0.067 Identities = 16/40 (40%), Positives = 23/40 (57%) Frame = +1 Query: 259 FGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMA 378 FG + V + NTGRSRGF FI F++ E++ +A Sbjct: 239 FGDQPGVLGAKVIYERNTGRSRGFGFISFESAENVQSALA 278 Score = 33.1 bits (72), Expect = 0.20 Identities = 16/50 (32%), Positives = 29/50 (58%), Gaps = 1/50 (2%) Frame = +3 Query: 510 GTILEVEMPFDKTKNQRKGFCFITFES-EQVVNDLLKTPKRTIGGKEVDV 656 GT+++V++ +DK ++ +GF F+T S E+ + IGG+ V V Sbjct: 140 GTVVDVQIVYDKVTDRSRGFGFVTMGSIEEAKEAMQMFNSSQIGGRTVKV 189 Score = 32.3 bits (70), Expect = 0.36 Identities = 20/79 (25%), Positives = 36/79 (45%) Frame = +1 Query: 259 FGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKVDPKKAKARH 438 FG G + + + D T RSRGF F+ + E + M N+ ++ + K Sbjct: 136 FGEAGTVVDVQIVYDKVTDRSRGFGFVTMGSIEEAKEAM----QMFNSSQIGGRTVKVNF 191 Query: 439 GKIFVGGLSSEISDDEIRN 495 ++ GG +E+ +IR+ Sbjct: 192 PEVPRGG-ENEVMRTKIRD 209 >At3g12640.1 68416.m01573 RNA recognition motif (RRM)-containing protein contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 674 Score = 34.7 bits (76), Expect = 0.067 Identities = 14/41 (34%), Positives = 23/41 (56%) Frame = +1 Query: 256 HFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMA 378 HF +GE+ + TDP TG+ G A+I F E+ + ++ Sbjct: 535 HFNKFGEVLKAFIVTDPATGQPSGSAYIEFTRKEAAENALS 575 >At3g08000.1 68416.m00977 RNA-binding protein, putative similar to RNA-binding protein from [Nicotiana tabacum] GI:15822703, [Nicotiana sylvestris] GI:624925; contains Pfam profile: PF00076 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Length = 143 Score = 34.7 bits (76), Expect = 0.067 Identities = 12/29 (41%), Positives = 19/29 (65%) Frame = +1 Query: 259 FGAYGEIESINVKTDPNTGRSRGFAFIVF 345 F ++GE+ + + D +GRSRGF F+ F Sbjct: 61 FSSFGEVAEVRIAYDKGSGRSRGFGFVDF 89 >At2g36660.1 68415.m04496 polyadenylate-binding protein, putative / PABP, putative Length = 609 Score = 34.7 bits (76), Expect = 0.067 Identities = 24/93 (25%), Positives = 48/93 (51%), Gaps = 10/93 (10%) Frame = +1 Query: 259 FGAYGEIESINVKTDPNTGRSRGFAFIVFK-------APESIDKVMAAGEHTINNK---K 408 F +G I S V T + G+SRG+ F+ F+ A ++++ + A + K K Sbjct: 132 FKKFGNIVSCKVATLED-GKSRGYGFVQFEQEDAAHAAIQTLNSTIVADKEIYVGKFMKK 190 Query: 409 VDPKKAKARHGKIFVGGLSSEISDDEIRNFFSE 507 D K + ++ +++ L +++S+D +R F+E Sbjct: 191 TDRVKPEEKYTNLYMKNLDADVSEDLLREKFAE 223 Score = 32.3 bits (70), Expect = 0.36 Identities = 17/40 (42%), Positives = 22/40 (55%), Gaps = 1/40 (2%) Frame = +1 Query: 256 HFGAYGEIESINVKTDPNTGRSRGFAFIVFKAP-ESIDKV 372 HF G I S + D G+S+GF F+ F P E+ID V Sbjct: 323 HFSQCGTITSTKLMCDEK-GKSKGFGFVCFSTPEEAIDAV 361 >At1g60650.2 68414.m06828 glycine-rich RNA-binding protein, putative similar to RNA binding protein(RZ-1) GI:1435061 from [Nicotiana sylvestris]; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 292 Score = 34.7 bits (76), Expect = 0.067 Identities = 19/62 (30%), Positives = 27/62 (43%), Gaps = 1/62 (1%) Frame = +1 Query: 259 FGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESI-DKVMAAGEHTINNKKVDPKKAKAR 435 F YG+I + +TGR RGF FI F D + + NK + KA+ + Sbjct: 32 FDRYGKITECQIMVGRDTGRPRGFGFITFTDRRGADDAIKHMHGRELGNKVISVNKAEPK 91 Query: 436 HG 441 G Sbjct: 92 VG 93 Score = 34.3 bits (75), Expect = 0.088 Identities = 18/56 (32%), Positives = 29/56 (51%), Gaps = 1/56 (1%) Frame = +3 Query: 510 GTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLK-TPKRTIGGKEVDVKRATPK 674 G I E ++ + + +GF FITF + +D +K R +G K + V +A PK Sbjct: 36 GKITECQIMVGRDTGRPRGFGFITFTDRRGADDAIKHMHGRELGNKVISVNKAEPK 91 Score = 29.5 bits (63), Expect = 2.5 Identities = 9/18 (50%), Positives = 16/18 (88%) Frame = +2 Query: 197 DRKLFVGGLSWETTDKEL 250 + ++FVGGLSW+ T+++L Sbjct: 11 ESRIFVGGLSWDVTERQL 28 >At1g60650.1 68414.m06827 glycine-rich RNA-binding protein, putative similar to RNA binding protein(RZ-1) GI:1435061 from [Nicotiana sylvestris]; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 292 Score = 34.7 bits (76), Expect = 0.067 Identities = 19/62 (30%), Positives = 27/62 (43%), Gaps = 1/62 (1%) Frame = +1 Query: 259 FGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESI-DKVMAAGEHTINNKKVDPKKAKAR 435 F YG+I + +TGR RGF FI F D + + NK + KA+ + Sbjct: 32 FDRYGKITECQIMVGRDTGRPRGFGFITFTDRRGADDAIKHMHGRELGNKVISVNKAEPK 91 Query: 436 HG 441 G Sbjct: 92 VG 93 Score = 34.3 bits (75), Expect = 0.088 Identities = 18/56 (32%), Positives = 29/56 (51%), Gaps = 1/56 (1%) Frame = +3 Query: 510 GTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLK-TPKRTIGGKEVDVKRATPK 674 G I E ++ + + +GF FITF + +D +K R +G K + V +A PK Sbjct: 36 GKITECQIMVGRDTGRPRGFGFITFTDRRGADDAIKHMHGRELGNKVISVNKAEPK 91 Score = 29.5 bits (63), Expect = 2.5 Identities = 9/18 (50%), Positives = 16/18 (88%) Frame = +2 Query: 197 DRKLFVGGLSWETTDKEL 250 + ++FVGGLSW+ T+++L Sbjct: 11 ESRIFVGGLSWDVTERQL 28 >At2g18510.1 68415.m02157 pre-mRNA splicing factor, putative similar to SP|Q15427 Splicing factor 3B subunit 4 (Spliceosome associated protein 49) (SAP 49) (SF3b50) (Pre-mRNA splicing factor SF3b 49 kDa subunit) {Homo sapiens}; contains Pfam profile PF00076: RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Length = 363 Score = 34.3 bits (75), Expect = 0.088 Identities = 19/52 (36%), Positives = 30/52 (57%), Gaps = 3/52 (5%) Frame = +1 Query: 259 FGAYGEIESI-NVKTDPNTGRSRGFAFIVFKAPESIDKVMAA--GEHTINNK 405 F A+G I S + DP+TG SRGF FI + + E+ D + + G++ N + Sbjct: 132 FSAFGVIASNPKIMRDPDTGNSRGFGFISYDSFEASDAAIESMTGQYLSNRQ 183 >At1g18630.1 68414.m02322 glycine-rich RNA-binding protein, putative similar to glycine-rich RNA-binding protein from {Sorghum bicolor} SP|Q99070, GI:1778373 from [Pisum sativum]; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 155 Score = 34.3 bits (75), Expect = 0.088 Identities = 18/52 (34%), Positives = 29/52 (55%) Frame = +1 Query: 259 FGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKVD 414 FG++G+I V D +G SRGF F+ + + E + M A + NK++D Sbjct: 56 FGSFGKIVDAVVVLDRESGLSRGFGFVTYDSIEVANNAMQA----MQNKELD 103 Score = 28.7 bits (61), Expect = 4.4 Identities = 13/53 (24%), Positives = 29/53 (54%), Gaps = 1/53 (1%) Frame = +3 Query: 510 GTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKT-PKRTIGGKEVDVKRA 665 G I++ + D+ +GF F+T++S +V N+ ++ + + G+ + V A Sbjct: 60 GKIVDAVVVLDRESGLSRGFGFVTYDSIEVANNAMQAMQNKELDGRIIGVHPA 112 >At4g24270.2 68417.m03484 RNA recognition motif (RRM)-containing protein low similarity to tumor-rejection antigen SART3 [Mus musculus] GI:7637845; contains INTERPRO:IPR000504 RNA-binding region RNP-1 (RNA recognition motif) domain Length = 817 Score = 33.9 bits (74), Expect = 0.12 Identities = 17/62 (27%), Positives = 29/62 (46%) Frame = +1 Query: 259 FGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKVDPKKAKARH 438 FG G ++SI + +TG+ RG A+ F E + +A KK+ ++ + Sbjct: 671 FGDDGGVDSIRILHHKDTGKPRGLAYADFVDDEHLAAAIAKNRKMFFGKKISIARSNPKK 730 Query: 439 GK 444 GK Sbjct: 731 GK 732 >At4g24270.1 68417.m03483 RNA recognition motif (RRM)-containing protein low similarity to tumor-rejection antigen SART3 [Mus musculus] GI:7637845; contains INTERPRO:IPR000504 RNA-binding region RNP-1 (RNA recognition motif) domain Length = 816 Score = 33.9 bits (74), Expect = 0.12 Identities = 17/62 (27%), Positives = 29/62 (46%) Frame = +1 Query: 259 FGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKVDPKKAKARH 438 FG G ++SI + +TG+ RG A+ F E + +A KK+ ++ + Sbjct: 671 FGDDGGVDSIRILHHKDTGKPRGLAYADFVDDEHLAAAIAKNRKMFFGKKISIARSNPKK 730 Query: 439 GK 444 GK Sbjct: 731 GK 732 >At2g24350.1 68415.m02910 RNA recognition motif (RRM)-containing protein low similarity to poly(A) binding protein II from [Xenopus laevis] GI:11527140, [Mus musculus] GI:2351846, [Bos taurus] GI:1051125; contains INTERPRO:IPR000504 RNA-binding region RNP-1 (RNA recognition motif) domain Length = 537 Score = 33.9 bits (74), Expect = 0.12 Identities = 14/36 (38%), Positives = 22/36 (61%) Frame = +1 Query: 271 GEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMA 378 G ++++ V TDP T +G AF+ F ES+ K +A Sbjct: 469 GAVQNVIVVTDPVTRHPKGTAFVTFATKESVGKAVA 504 >At1g60900.1 68414.m06856 U2 snRNP auxiliary factor large subunit, putative similar to U2 snRNP auxiliary factor, large subunit GB:CAA77136 from [Nicotiana plumbaginifolia] Length = 589 Score = 33.9 bits (74), Expect = 0.12 Identities = 14/39 (35%), Positives = 22/39 (56%) Frame = +1 Query: 265 AYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA 381 ++G + N+ D TG S+G+AF V++ P D AA Sbjct: 397 SFGPLRGFNLVKDRETGNSKGYAFCVYQDPSVTDIACAA 435 >At1g51510.1 68414.m05797 RNA-binding protein, putative similar to RNA-binding protein 8 (Ribonucleoprotein RBM8) SP:Q9Y5S9 from [Homo sapiens], RNA-binding protein Y14 [Xenopus laevis] GI:11034807; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 202 Score = 33.9 bits (74), Expect = 0.12 Identities = 13/41 (31%), Positives = 25/41 (60%) Frame = +1 Query: 259 FGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA 381 FG +GEI+++N+ D +G +G+A I ++ E ++A Sbjct: 115 FGDFGEIKNLNLNLDRRSGYVKGYALIEYEKKEEAQSAISA 155 >At5g50250.1 68418.m06223 31 kDa ribonucleoprotein, chloroplast, putative / RNA-binding protein RNP-T, putative / RNA-binding protein 1/2/3, putative / RNA-binding protein cp31, putative similar to SP|Q04836 31 kDa ribonucleoprotein, chloroplast precursor (RNA-binding protein RNP-T) (1/2/3) (AtRBP33) (cp31) {Arabidopsis thaliana}; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 289 Score = 33.5 bits (73), Expect = 0.15 Identities = 14/41 (34%), Positives = 22/41 (53%) Frame = +1 Query: 259 FGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA 381 F +G++ V +D TGRSRGF F+ ++ +AA Sbjct: 227 FSEHGKVVDARVVSDRETGRSRGFGFVQMSNENEVNVAIAA 267 Score = 30.3 bits (65), Expect = 1.4 Identities = 16/61 (26%), Positives = 32/61 (52%), Gaps = 1/61 (1%) Frame = +3 Query: 495 LLQ*IGTILEVEMPFDKTKNQRKGFCFITFES-EQVVNDLLKTPKRTIGGKEVDVKRATP 671 L + GT+ E+ +++ +Q +GF F+T + E+ + K + G+ + V RA P Sbjct: 132 LFEQAGTVEISEVIYNRDTDQSRGFGFVTMSTVEEAEKAVEKFNSFEVNGRRLTVNRAAP 191 Query: 672 K 674 + Sbjct: 192 R 192 Score = 29.1 bits (62), Expect = 3.3 Identities = 23/97 (23%), Positives = 39/97 (40%), Gaps = 14/97 (14%) Frame = +1 Query: 259 FGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDK-VMAAGEHTINNKKVDPKKAKAR 435 F G +E V + +T +SRGF F+ E +K V +N +++ +A R Sbjct: 133 FEQAGTVEISEVIYNRDTDQSRGFGFVTMSTVEEAEKAVEKFNSFEVNGRRLTVNRAAPR 192 Query: 436 HG-------------KIFVGGLSSEISDDEIRNFFSE 507 +I+VG L ++ + FSE Sbjct: 193 GSRPERQPRVYDAAFRIYVGNLPWDVDSGRLERLFSE 229 >At4g34110.1 68417.m04839 polyadenylate-binding protein 2 (PABP2) non-consensus TA donor splice site at exon 2, polyadenylate-binding protein - Triticum aestivum (common wheat),PIR:T06979 Length = 443 Score = 33.5 bits (73), Expect = 0.15 Identities = 15/40 (37%), Positives = 21/40 (52%) Frame = +1 Query: 259 FGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMA 378 F +G + S V DPN G S+G F+ F PE + M+ Sbjct: 152 FSPFGTVTSSKVMRDPN-GTSKGSGFVAFATPEEATEAMS 190 >At3g54770.1 68416.m06060 RNA recognition motif (RRM)-containing protein low similarity to RRM-containing protein SEB-4 [Xenopus laevis] GI:8895698; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 261 Score = 33.5 bits (73), Expect = 0.15 Identities = 15/53 (28%), Positives = 27/53 (50%) Frame = +1 Query: 256 HFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKVD 414 HF YG+I + +D T RS+G+ F+ FK ++ + IN ++ + Sbjct: 36 HFIKYGDILEAVIISDKLTRRSKGYGFVTFKDAKAATRACEDSTPIINGRRAN 88 Score = 27.9 bits (59), Expect = 7.7 Identities = 14/53 (26%), Positives = 24/53 (45%) Frame = +3 Query: 510 GTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPKRTIGGKEVDVKRAT 668 G ILE + DK + KG+ F+TF+ + + I G+ + A+ Sbjct: 41 GDILEAVIISDKLTRRSKGYGFVTFKDAKAATRACEDSTPIINGRRANCNLAS 93 >At3g53460.2 68416.m05901 29 kDa ribonucleoprotein, chloroplast / RNA-binding protein cp 29 nearly identical to SP|Q43349 29 kDa ribonucleoprotein, chloroplast precursor (RNA-binding protein cp29) {Arabidopsis thaliana} Length = 334 Score = 33.5 bits (73), Expect = 0.15 Identities = 15/57 (26%), Positives = 29/57 (50%), Gaps = 1/57 (1%) Frame = +3 Query: 510 GTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK-RTIGGKEVDVKRATPKP 677 G ++E + +D+ + KGF F+T S Q V + + + G+++ V A +P Sbjct: 273 GKVVEARVIYDRDSGRSKGFGFVTLSSSQEVQKAINSLNGADLDGRQIRVSEAEARP 329 Score = 31.9 bits (69), Expect = 0.47 Identities = 13/36 (36%), Positives = 19/36 (52%) Frame = +1 Query: 259 FGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESID 366 F + G +E + V D TGRSRGF F+ ++ Sbjct: 119 FESAGNVEMVEVIYDKVTGRSRGFGFVTMSTAAEVE 154 Score = 31.9 bits (69), Expect = 0.47 Identities = 14/60 (23%), Positives = 32/60 (53%), Gaps = 1/60 (1%) Frame = +1 Query: 259 FGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDK-VMAAGEHTINNKKVDPKKAKAR 435 F G++ V D ++GRS+GF F+ + + + K + + ++ +++ +A+AR Sbjct: 269 FNEQGKVVEARVIYDRDSGRSKGFGFVTLSSSQEVQKAINSLNGADLDGRQIRVSEAEAR 328 >At3g53460.1 68416.m05900 29 kDa ribonucleoprotein, chloroplast / RNA-binding protein cp 29 nearly identical to SP|Q43349 29 kDa ribonucleoprotein, chloroplast precursor (RNA-binding protein cp29) {Arabidopsis thaliana} Length = 342 Score = 33.5 bits (73), Expect = 0.15 Identities = 15/57 (26%), Positives = 29/57 (50%), Gaps = 1/57 (1%) Frame = +3 Query: 510 GTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK-RTIGGKEVDVKRATPKP 677 G ++E + +D+ + KGF F+T S Q V + + + G+++ V A +P Sbjct: 281 GKVVEARVIYDRDSGRSKGFGFVTLSSSQEVQKAINSLNGADLDGRQIRVSEAEARP 337 Score = 31.9 bits (69), Expect = 0.47 Identities = 13/36 (36%), Positives = 19/36 (52%) Frame = +1 Query: 259 FGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESID 366 F + G +E + V D TGRSRGF F+ ++ Sbjct: 119 FESAGNVEMVEVIYDKVTGRSRGFGFVTMSTAAEVE 154 Score = 31.9 bits (69), Expect = 0.47 Identities = 14/60 (23%), Positives = 32/60 (53%), Gaps = 1/60 (1%) Frame = +1 Query: 259 FGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDK-VMAAGEHTINNKKVDPKKAKAR 435 F G++ V D ++GRS+GF F+ + + + K + + ++ +++ +A+AR Sbjct: 277 FNEQGKVVEARVIYDRDSGRSKGFGFVTLSSSQEVQKAINSLNGADLDGRQIRVSEAEAR 336 >At1g71770.1 68414.m08295 polyadenylate-binding protein 5 (PABP5) identical to GB:Q05196 from [Arabidopsis thaliana] Length = 668 Score = 33.5 bits (73), Expect = 0.15 Identities = 16/34 (47%), Positives = 21/34 (61%) Frame = +1 Query: 259 FGAYGEIESINVKTDPNTGRSRGFAFIVFKAPES 360 FG YG+I S V D +G SR F F+ F +PE+ Sbjct: 245 FGKYGDISSAVVMKD-QSGNSRSFGFVNFVSPEA 277 Score = 29.1 bits (62), Expect = 3.3 Identities = 13/33 (39%), Positives = 18/33 (54%) Frame = +1 Query: 259 FGAYGEIESINVKTDPNTGRSRGFAFIVFKAPE 357 F YG + S V + + G SRGF F+ + PE Sbjct: 348 FSEYGNVTSCKVMMN-SQGLSRGFGFVAYSNPE 379 Score = 28.3 bits (60), Expect = 5.8 Identities = 21/90 (23%), Positives = 39/90 (43%), Gaps = 8/90 (8%) Frame = +1 Query: 259 FGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHT-INNKKV-------D 414 F + ++ V D T RS G+A++ F PE + M + + I ++ + D Sbjct: 65 FNQVAPVHNLRVCRDL-THRSLGYAYVNFANPEDASRAMESLNYAPIRDRPIRIMLSNRD 123 Query: 415 PKKAKARHGKIFVGGLSSEISDDEIRNFFS 504 P + G +F+ L + I + + FS Sbjct: 124 PSTRLSGKGNVFIKNLDASIDNKALYETFS 153 >At4g24770.1 68417.m03546 31 kDa ribonucleoprotein, chloroplast, putative / RNA-binding protein RNP-T, putative / RNA-binding protein 1/2/3, putative / RNA-binding protein cp31, putative similar to SP|Q04836 31 kDa ribonucleoprotein, chloroplast precursor (RNA-binding protein RNP-T) (RNA-binding protein 1/2/3) (AtRBP33) (RNA-binding protein cp31) {Arabidopsis thaliana}; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 329 Score = 33.1 bits (72), Expect = 0.20 Identities = 13/41 (31%), Positives = 23/41 (56%) Frame = +1 Query: 259 FGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA 381 F +G++ V D TGRSRGF F+ + +++ ++A Sbjct: 264 FSEHGKVVEARVVYDRETGRSRGFGFVTMSDVDELNEAISA 304 Score = 29.5 bits (63), Expect = 2.5 Identities = 15/61 (24%), Positives = 33/61 (54%), Gaps = 1/61 (1%) Frame = +3 Query: 495 LLQ*IGTILEVEMPFDKTKNQRKGFCFITFES-EQVVNDLLKTPKRTIGGKEVDVKRATP 671 L + GT+ E+ +++ +Q +GF F+T S ++ + K + + G+ + V +A P Sbjct: 169 LFEQAGTVEIAEVIYNRETDQSRGFGFVTMSSVDEAETAVEKFNRYDLNGRLLTVNKAAP 228 Query: 672 K 674 + Sbjct: 229 R 229 Score = 28.3 bits (60), Expect = 5.8 Identities = 12/57 (21%), Positives = 28/57 (49%), Gaps = 1/57 (1%) Frame = +3 Query: 510 GTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKT-PKRTIGGKEVDVKRATPKP 677 G ++E + +D+ + +GF F+T +N+ + + + G+ + V A +P Sbjct: 268 GKVVEARVVYDRETGRSRGFGFVTMSDVDELNEAISALDGQNLEGRAIRVNVAEERP 324 >At2g27330.1 68415.m03286 RNA recognition motif (RRM)-containing protein Length = 116 Score = 33.1 bits (72), Expect = 0.20 Identities = 16/48 (33%), Positives = 29/48 (60%), Gaps = 1/48 (2%) Frame = +3 Query: 510 GTILEVEMPFDKTKNQRKGFCFITFES-EQVVNDLLKTPKRTIGGKEV 650 G +L+V++ DK + + KGF ++TF S E+ LL+ + + G+ V Sbjct: 45 GQVLKVDVIMDKIRCRPKGFAYVTFSSKEEAEKALLELNAQLVDGRVV 92 Score = 31.9 bits (69), Expect = 0.47 Identities = 12/39 (30%), Positives = 22/39 (56%) Frame = +1 Query: 259 FGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVM 375 F YG++ ++V D R +GFA++ F + E +K + Sbjct: 41 FSQYGQVLKVDVIMDKIRCRPKGFAYVTFSSKEEAEKAL 79 >At1g72800.1 68414.m08416 nuM1-related contains similarity with nuM1 GI:1279563 from [Medicago sativa] Length = 335 Score = 33.1 bits (72), Expect = 0.20 Identities = 16/47 (34%), Positives = 25/47 (53%) Frame = +1 Query: 256 HFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTI 396 +F ++GEI + V TG S G+A+I K E +K + G H + Sbjct: 257 YFSSFGEITRVFVPPSHGTGGSLGYAYIDLK--EGAEKALELGRHDV 301 >At5g04600.1 68418.m00460 RNA recognition motif (RRM)-containing protein contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 222 Score = 32.7 bits (71), Expect = 0.27 Identities = 19/65 (29%), Positives = 33/65 (50%), Gaps = 8/65 (12%) Frame = +1 Query: 259 FGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAG--------EHTINNKKVD 414 F +G ++ + V + TG+S+ F FI F+ PE + +AAG EH + ++ Sbjct: 80 FSQFGTVKRVRVARNKKTGKSKHFGFIQFEDPEVAE--IAAGAMNDYLLMEHMLKVHVIE 137 Query: 415 PKKAK 429 P+ K Sbjct: 138 PENVK 142 >At4g39260.4 68417.m05560 glycine-rich RNA-binding protein 8 (GRP8) (CCR1) SP|Q03251 Glycine-rich RNA-binding protein 8 (CCR1 protein) (GRP8) {Arabidopsis thaliana} isoform contains a non-consensus CG acceptor splice site at intron 2 Length = 105 Score = 32.7 bits (71), Expect = 0.27 Identities = 12/30 (40%), Positives = 18/30 (60%) Frame = +1 Query: 259 FGAYGEIESINVKTDPNTGRSRGFAFIVFK 348 F +G++ + D +GRSRGF F+ FK Sbjct: 26 FSQFGDVIDSKIINDRESGRSRGFGFVTFK 55 Score = 30.7 bits (66), Expect = 1.1 Identities = 12/51 (23%), Positives = 28/51 (54%) Frame = +3 Query: 489 QKLLQ*IGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPKRTIGG 641 Q+ G +++ ++ D+ + +GF F+TF+ E+ + D ++ + GG Sbjct: 23 QRTFSQFGDVIDSKIINDRESGRSRGFGFVTFKDEKAMRDAIEEMNGSGGG 73 >At3g54230.1 68416.m05994 zinc finger protein-related / D111/G-patch domain-containing protein / RNA recognition motif (RRM)-containing protein KIAA0122 gene , Homo sapiens, EMBL:HSDKG02; contains Pfam profiles PF00076: RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain), PF01585: G-patch domain, weak hit to PF00641: Zn-finger in Ran binding protein and others Length = 1105 Score = 32.3 bits (70), Expect = 0.36 Identities = 21/64 (32%), Positives = 30/64 (46%), Gaps = 3/64 (4%) Frame = +1 Query: 259 FGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTI---NNKKVDPKKAK 429 F + I+ + + D T SRGFAF+ F + E K + A T N K + AK Sbjct: 478 FSKHAPIKDLRLVRDKFTHVSRGFAFVHFYSVEDATKALEATNRTALERNGKILRVAYAK 537 Query: 430 ARHG 441 + HG Sbjct: 538 SVHG 541 Score = 31.5 bits (68), Expect = 0.62 Identities = 15/41 (36%), Positives = 23/41 (56%) Frame = +1 Query: 268 YGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEH 390 +G + + V + N+G SRGFAFI F ++ +M EH Sbjct: 321 WGPLHHVRVIREQNSGISRGFAFIDFPTVDAARTMMDRIEH 361 >At3g20930.1 68416.m02645 RNA recognition motif (RRM)-containing protein contains Pfam profile: PF00076 RNA recognition motif Length = 374 Score = 32.3 bits (70), Expect = 0.36 Identities = 16/38 (42%), Positives = 25/38 (65%) Frame = +2 Query: 152 DSQDHNSAEAPGRDDDRKLFVGGLSWETTDKELRVILE 265 DS+D + +E+P +KLF+ GLS+ T++K LR E Sbjct: 267 DSRDQDDSESPPVKT-KKLFITGLSFYTSEKTLRAAFE 303 >At3g10400.1 68416.m01246 RNA recognition motif (RRM)-containing protein low similarity to splicing factor SC35 [Arabidopsis thaliana] GI:9843653; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 261 Score = 32.3 bits (70), Expect = 0.36 Identities = 23/102 (22%), Positives = 45/102 (44%) Frame = +1 Query: 259 FGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKVDPKKAKARH 438 F +G++ + V D +T +SRG AF+++ + E K + + I N + A + Sbjct: 77 FSTFGKVARVTVLKDRHTRQSRGVAFVLYVSREDAAKAARSMDAKILNGRKLTVSIAADN 136 Query: 439 GKIFVGGLSSEISDDEIRNFFSELELS*KWRCPLTKQRTKER 564 G+ + + D+ R + E + CP + +ER Sbjct: 137 GRA-SEFIKKRVYKDKSRCYECGDEGHLSYECPKNQLGPRER 177 >At5g47320.1 68418.m05833 30S ribosomal protein S19, mitochondrial (RPS19) Length = 212 Score = 31.9 bits (69), Expect = 0.47 Identities = 13/41 (31%), Positives = 24/41 (58%) Frame = +1 Query: 259 FGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA 381 F ++ + V T+ TGRSRG+ F+ F + +S + ++A Sbjct: 51 FSSFNGVTEARVMTNKVTGRSRGYGFVNFISEDSANSAISA 91 >At4g13850.2 68417.m02146 glycine-rich RNA-binding protein (GRP2) glycine-rich RNA binding protein 2 AtGRP2 [Arabidopsis thaliana] GI:2826811 Length = 153 Score = 31.9 bits (69), Expect = 0.47 Identities = 13/29 (44%), Positives = 17/29 (58%) Frame = +1 Query: 259 FGAYGEIESINVKTDPNTGRSRGFAFIVF 345 F +G++ V D TGRSRGF F+ F Sbjct: 55 FAHFGDVVDAKVIVDRETGRSRGFGFVNF 83 Score = 31.5 bits (68), Expect = 0.62 Identities = 13/22 (59%), Positives = 14/22 (63%) Frame = +2 Query: 203 KLFVGGLSWETTDKELRVILEH 268 KLF+GGLSW T D LR H Sbjct: 36 KLFIGGLSWGTDDASLRDAFAH 57 >At4g13850.1 68417.m02145 glycine-rich RNA-binding protein (GRP2) glycine-rich RNA binding protein 2 AtGRP2 [Arabidopsis thaliana] GI:2826811 Length = 158 Score = 31.9 bits (69), Expect = 0.47 Identities = 13/29 (44%), Positives = 17/29 (58%) Frame = +1 Query: 259 FGAYGEIESINVKTDPNTGRSRGFAFIVF 345 F +G++ V D TGRSRGF F+ F Sbjct: 55 FAHFGDVVDAKVIVDRETGRSRGFGFVNF 83 Score = 31.5 bits (68), Expect = 0.62 Identities = 13/22 (59%), Positives = 14/22 (63%) Frame = +2 Query: 203 KLFVGGLSWETTDKELRVILEH 268 KLF+GGLSW T D LR H Sbjct: 36 KLFIGGLSWGTDDASLRDAFAH 57 >At1g54080.1 68414.m06162 oligouridylate-binding protein, putative similar to oligouridylate binding protein GI:6996560 from [Nicotiana plumbaginifolia] Length = 426 Score = 31.9 bits (69), Expect = 0.47 Identities = 13/30 (43%), Positives = 16/30 (53%) Frame = +1 Query: 259 FGAYGEIESINVKTDPNTGRSRGFAFIVFK 348 F A+ V D TGRSRGF F+ F+ Sbjct: 168 FSAFNSCSDARVMWDQKTGRSRGFGFVSFR 197 >At5g06210.1 68418.m00693 RNA-binding protein, putative contains similarity to RNA-binding protein from [Nicotiana tabacum] GI:15822703, [Nicotiana sylvestris] GI:624925, [Solanum tuberosum] GI:15822705; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 146 Score = 31.5 bits (68), Expect = 0.62 Identities = 15/56 (26%), Positives = 31/56 (55%), Gaps = 1/56 (1%) Frame = +3 Query: 510 GTILEVEMPFDKTKNQRKGFCFITFES-EQVVNDLLKTPKRTIGGKEVDVKRATPK 674 G ++E ++ D+ ++ KGF F+TF S ++ L++ + + G+ + V A K Sbjct: 58 GQVVEAQIVMDRVSDRSKGFGFVTFASADEAQKALMEFNGQQLNGRTIFVDYAKAK 113 Score = 29.5 bits (63), Expect = 2.5 Identities = 15/60 (25%), Positives = 28/60 (46%), Gaps = 1/60 (1%) Frame = +1 Query: 259 FGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDK-VMAAGEHTINNKKVDPKKAKAR 435 F G++ + D + RS+GF F+ F + + K +M +N + + AKA+ Sbjct: 54 FSKCGQVVEAQIVMDRVSDRSKGFGFVTFASADEAQKALMEFNGQQLNGRTIFVDYAKAK 113 >At4g13860.1 68417.m02147 glycine-rich RNA-binding protein, putative similar to Glycine-rich RNA-binding protein 2, mitochondrial precursor (AtGRP2) (Swiss-Prot:Q9SVM8) [Arabidopsis thaliana] ; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 87 Score = 31.5 bits (68), Expect = 0.62 Identities = 15/55 (27%), Positives = 26/55 (47%), Gaps = 1/55 (1%) Frame = +1 Query: 259 FGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGE-HTINNKKVDPK 420 F YG + V D T RSRGF F+ + + + ++ + +N ++V K Sbjct: 23 FSGYGNVVDAIVMRDRYTDRSRGFGFVTYSSHSEAEAAVSGMDGKELNGRRVSVK 77 >At1g49600.1 68414.m05561 RNA-binding protein 47 (RBP47), putative similar to DNA binding protein ACBF GB:U90212 GI:1899187 from [Nicotiana tabacum] Length = 445 Score = 31.5 bits (68), Expect = 0.62 Identities = 12/28 (42%), Positives = 17/28 (60%) Frame = +1 Query: 262 GAYGEIESINVKTDPNTGRSRGFAFIVF 345 G Y ++ V D NTGRS+G+ F+ F Sbjct: 235 GRYPSVKGAKVVIDSNTGRSKGYGFVRF 262 >At5g46840.1 68418.m05771 RNA recognition motif (RRM)-containing protein contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 501 Score = 31.1 bits (67), Expect = 0.82 Identities = 13/51 (25%), Positives = 28/51 (54%) Frame = +1 Query: 277 IESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKVDPKKAK 429 IE++ V DP+ +G A+++FK E+ + V+ G + +++ + K Sbjct: 313 IEAVRVIRDPHLNIGKGIAYVLFKTREAANLVLKKGYLKLRERELRISRVK 363 >At1g11650.2 68414.m01337 RNA-binding protein 45 (RBP45), putative similar to gb|U90212 DNA binding protein ACBF from Nicotiana tabacum and contains 3 PF|00076 RNA recognition motif domains. ESTs gb|T44278, gb|R65195, gb|N65904, gb|H37499, gb|R90487, gb|N95952, gb|T44278, gb|Z20166, gb|N96891, gb|W43137, gb|F15504, gb|F1 Length = 405 Score = 31.1 bits (67), Expect = 0.82 Identities = 10/21 (47%), Positives = 17/21 (80%) Frame = +1 Query: 445 IFVGGLSSEISDDEIRNFFSE 507 +FVGGL + ++DD ++N FS+ Sbjct: 263 VFVGGLDASVTDDHLKNVFSQ 283 >At1g11650.1 68414.m01336 RNA-binding protein 45 (RBP45), putative similar to gb|U90212 DNA binding protein ACBF from Nicotiana tabacum and contains 3 PF|00076 RNA recognition motif domains. ESTs gb|T44278, gb|R65195, gb|N65904, gb|H37499, gb|R90487, gb|N95952, gb|T44278, gb|Z20166, gb|N96891, gb|W43137, gb|F15504, gb|F1 Length = 306 Score = 31.1 bits (67), Expect = 0.82 Identities = 10/21 (47%), Positives = 17/21 (80%) Frame = +1 Query: 445 IFVGGLSSEISDDEIRNFFSE 507 +FVGGL + ++DD ++N FS+ Sbjct: 263 VFVGGLDASVTDDHLKNVFSQ 283 >At4g20030.1 68417.m02932 RNA recognition motif (RRM)-containing protein low similarity to heterogeneous nuclear ribonucleoprotein G [Mus musculus] GI:5579009; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 152 Score = 30.7 bits (66), Expect = 1.1 Identities = 13/33 (39%), Positives = 20/33 (60%) Frame = +1 Query: 259 FGAYGEIESINVKTDPNTGRSRGFAFIVFKAPE 357 F A+GEI + + D RS+G+AFI F + + Sbjct: 60 FSAFGEIAEVKLIKDEAMKRSKGYAFIQFTSQD 92 >At3g46020.1 68416.m04979 RNA-binding protein, putative similar to Cold-inducible RNA-binding protein (Glycine-rich RNA-binding protein CIRP) from {Homo sapiens} SP|Q14011, {Rattus norvegicus} SP|Q61413,{Xenopus laevis}; SP|O93235; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 102 Score = 30.7 bits (66), Expect = 1.1 Identities = 20/55 (36%), Positives = 27/55 (49%) Frame = +3 Query: 489 QKLLQ*IGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPKRTIGGKEVD 653 ++L G I E + D + KGF FITF+SE LK ++ GK VD Sbjct: 24 RQLFSPFGQIKEARLIRDSETQRPKGFGFITFDSEDDARKALK----SLDGKIVD 74 Score = 29.9 bits (64), Expect = 1.9 Identities = 12/39 (30%), Positives = 20/39 (51%) Frame = +1 Query: 259 FGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVM 375 F +G+I+ + D T R +GF FI F + + K + Sbjct: 27 FSPFGQIKEARLIRDSETQRPKGFGFITFDSEDDARKAL 65 >At1g17370.1 68414.m02118 oligouridylate-binding protein, putative similar to oligouridylate binding protein [Nicotiana plumbaginifolia] GI:6996560; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 419 Score = 30.7 bits (66), Expect = 1.1 Identities = 13/30 (43%), Positives = 15/30 (50%) Frame = +1 Query: 259 FGAYGEIESINVKTDPNTGRSRGFAFIVFK 348 F Y V D TGRSRGF F+ F+ Sbjct: 159 FSVYPTCSDARVMWDQKTGRSRGFGFVSFR 188 >At5g54900.1 68418.m06838 RNA-binding protein 45 (RBP45), putative contains similarity to polyadenylate-binding protein 5 Length = 387 Score = 30.3 bits (65), Expect = 1.4 Identities = 10/21 (47%), Positives = 17/21 (80%) Frame = +1 Query: 445 IFVGGLSSEISDDEIRNFFSE 507 IFVGGL + ++DDE+++ F + Sbjct: 262 IFVGGLDANVTDDELKSIFGQ 282 Score = 29.9 bits (64), Expect = 1.9 Identities = 11/26 (42%), Positives = 16/26 (61%) Frame = +1 Query: 268 YGEIESINVKTDPNTGRSRGFAFIVF 345 YG ++ V D TGRS+G+ F+ F Sbjct: 178 YGSVKGAKVVLDRTTGRSKGYGFVRF 203 >At3g14100.1 68416.m01782 oligouridylate-binding protein, putative similar to GB:CAB75429 (GI:6996560) from [Nicotiana plumbaginifolia], contains Pfam profiles: PF00076 RNA recognition motif (3 copies) Length = 427 Score = 30.3 bits (65), Expect = 1.4 Identities = 12/30 (40%), Positives = 15/30 (50%) Frame = +1 Query: 259 FGAYGEIESINVKTDPNTGRSRGFAFIVFK 348 F + V D TGRSRGF F+ F+ Sbjct: 164 FSVFSSCSDARVMWDQKTGRSRGFGFVSFR 193 >At3g11400.1 68416.m01390 eukaryotic translation initiation factor 3G / eIF3g nearly identical to eukaryotic translation initiation factor 3g [Arabidopsis thaliana] GI:12407751 Length = 294 Score = 30.3 bits (65), Expect = 1.4 Identities = 13/39 (33%), Positives = 20/39 (51%) Frame = +1 Query: 259 FGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVM 375 F +G + + V D TG SRGF F+ F + E + + Sbjct: 233 FHPFGAVTRVYVAIDQKTGVSRGFGFVNFVSREDAQRAI 271 >At1g47500.1 68414.m05272 RNA-binding protein 47 (RBP47), putative similar to DNA binding protein GI:1899187 from [Nicotiana tabacum] Length = 434 Score = 30.3 bits (65), Expect = 1.4 Identities = 13/36 (36%), Positives = 19/36 (52%) Frame = +1 Query: 268 YGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVM 375 Y +++ V D NTGRS+G+ F+ F K M Sbjct: 223 YPSVKAAKVVLDANTGRSKGYGFVRFGDENERTKAM 258 Score = 29.5 bits (63), Expect = 2.5 Identities = 11/21 (52%), Positives = 17/21 (80%) Frame = +1 Query: 445 IFVGGLSSEISDDEIRNFFSE 507 IFVGGL S ++D++++ FSE Sbjct: 308 IFVGGLDSSVTDEDLKQPFSE 328 >At5g54580.1 68418.m06794 RNA recognition motif (RRM)-containing protein low similarity to RNA-binding protein RGP-3 [Nicotiana sylvestris] GI:1009363; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 156 Score = 29.9 bits (64), Expect = 1.9 Identities = 14/40 (35%), Positives = 21/40 (52%) Frame = +1 Query: 259 FGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMA 378 F +GE+ V TD +G S+GF F+ + E K +A Sbjct: 76 FAQFGEVADAKVVTDRVSGYSKGFGFVRYATLEDSAKGIA 115 >At3g63450.1 68416.m07144 RNA recognition motif (RRM)-containing protein contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 399 Score = 29.9 bits (64), Expect = 1.9 Identities = 16/65 (24%), Positives = 33/65 (50%), Gaps = 1/65 (1%) Frame = +1 Query: 256 HFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGE-HTINNKKVDPKKAKA 432 +F +G ++ + + + R F F+ F PE++ ++A G H + + +V K K Sbjct: 175 YFSTFGPVQDVRIPYQ----QKRMFGFVTFMYPETVKSILAKGNPHFVCHSRVLVKPYKE 230 Query: 433 RHGKI 447 + GK+ Sbjct: 231 K-GKV 234 >At2g39260.1 68415.m04821 MIF4G domain-containing protein similar to hUPF2 [Homo sapiens] GI:12232320; contains Pfam profile PF02854: MIF4G domain Length = 1186 Score = 29.9 bits (64), Expect = 1.9 Identities = 12/28 (42%), Positives = 17/28 (60%), Gaps = 2/28 (7%) Frame = +2 Query: 125 NGNAENGG--GDSQDHNSAEAPGRDDDR 202 +GN E G GD D++ + PG DDD+ Sbjct: 962 DGNHERGSESGDGDDYDDGDGPGSDDDK 989 >At2g21440.1 68415.m02551 RNA recognition motif (RRM)-containing protein contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 1003 Score = 29.9 bits (64), Expect = 1.9 Identities = 16/42 (38%), Positives = 24/42 (57%), Gaps = 1/42 (2%) Frame = +1 Query: 259 FGAYGEIESINVKTDPNTGRSRGFAFIVFK-APESIDKVMAA 381 F +GE+ES+++ T R G AF+ FK A S+ + AA Sbjct: 581 FTVFGEVESLSLVLHKVTKRPEGTAFVKFKTADASVAAISAA 622 Score = 28.7 bits (61), Expect = 4.4 Identities = 14/60 (23%), Positives = 28/60 (46%), Gaps = 1/60 (1%) Frame = +1 Query: 259 FGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDK-VMAAGEHTINNKKVDPKKAKAR 435 F G + + T+ + RGFAF+ F E +++ + T+ +++ K+A R Sbjct: 40 FSEVGPVRRCFLVTNKGSDEHRGFAFVKFALQEDVNRAIELKNGSTVGGRRITVKQAAHR 99 >At4g35785.2 68417.m05083 transformer serine/arginine-rich ribonucleoprotein, putative similar to transformer-SR ribonucleoprotein [Nicotiana tabacum] gi|1781299|emb|CAA70700 Length = 141 Score = 29.5 bits (63), Expect = 2.5 Identities = 12/38 (31%), Positives = 21/38 (55%) Frame = +1 Query: 256 HFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDK 369 HF G++ S + +P T SRGFAF+ + + ++ Sbjct: 91 HFAKEGKVASCFLVMEPRTRVSRGFAFVTMSSLKDAER 128 >At4g35785.1 68417.m05082 transformer serine/arginine-rich ribonucleoprotein, putative similar to transformer-SR ribonucleoprotein [Nicotiana tabacum] gi|1781299|emb|CAA70700 Length = 140 Score = 29.5 bits (63), Expect = 2.5 Identities = 12/38 (31%), Positives = 21/38 (55%) Frame = +1 Query: 256 HFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDK 369 HF G++ S + +P T SRGFAF+ + + ++ Sbjct: 90 HFAKEGKVASCFLVMEPRTRVSRGFAFVTMSSLKDAER 127 >At3g51950.1 68416.m05698 zinc finger (CCCH-type) family protein / RNA recognition motif (RRM)-containing protein contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM), PF00642: Zinc finger C-x8-C-x5-C-x3-H type (and similar) Length = 540 Score = 29.5 bits (63), Expect = 2.5 Identities = 16/65 (24%), Positives = 33/65 (50%), Gaps = 1/65 (1%) Frame = +1 Query: 256 HFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGE-HTINNKKVDPKKAKA 432 +F +G ++ + + + R F F+ F PE++ ++A G H + + +V K K Sbjct: 278 YFSTFGPVQDVRIPYQ----QKRMFGFVTFVYPETVKSILAKGNPHFVCDSRVLVKPYKE 333 Query: 433 RHGKI 447 + GK+ Sbjct: 334 K-GKV 337 >At3g50670.1 68416.m05542 U1 small nuclear ribonucleoprotein 70 (U1-70k) Length = 427 Score = 29.5 bits (63), Expect = 2.5 Identities = 11/29 (37%), Positives = 20/29 (68%) Frame = +1 Query: 259 FGAYGEIESINVKTDPNTGRSRGFAFIVF 345 F +YG I+ +++ TD T + +G+AFI + Sbjct: 158 FESYGPIKRVHLVTDQLTNKPKGYAFIEY 186 >At3g18810.1 68416.m02389 protein kinase family protein contains Pfam PF00069: Protein kinase domain Length = 700 Score = 29.5 bits (63), Expect = 2.5 Identities = 15/40 (37%), Positives = 20/40 (50%) Frame = +2 Query: 83 NDNFAQDITTDNQLNGNAENGGGDSQDHNSAEAPGRDDDR 202 NDN + +N N N NGGG ++ S P R+ DR Sbjct: 119 NDNNGNNNNGNNNDNNNQNNGGG--SNNRSPPPPSRNSDR 156 Score = 27.9 bits (59), Expect = 7.7 Identities = 11/31 (35%), Positives = 18/31 (58%) Frame = +2 Query: 80 NNDNFAQDITTDNQLNGNAENGGGDSQDHNS 172 NN N D +N N N +N G+++D+N+ Sbjct: 76 NNGNNNNDNNNNNNGNNNNDNNNGNNKDNNN 106 >At2g21690.1 68415.m02580 RNA-binding protein, putative similar to Glycine-rich RNA-binding protein from {Sinapis alba} SP|P49311, {Brassica napus} SP|Q05966, {Arabidopsis thaliana} SP|Q03251; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 117 Score = 29.5 bits (63), Expect = 2.5 Identities = 13/40 (32%), Positives = 23/40 (57%), Gaps = 1/40 (2%) Frame = +1 Query: 259 FGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESI-DKVM 375 F +G + + D +TG+SR F F+ F+ +S+ D +M Sbjct: 27 FSKFGNVIDSKIIYDRDTGKSRRFGFVTFEEEKSMTDAIM 66 >At1g60200.1 68414.m06781 splicing factor PWI domain-containing protein / RNA recognition motif (RRM)-containing protein contains Pfam profiles PF01480: PWI domain, PF00076: RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Length = 899 Score = 29.5 bits (63), Expect = 2.5 Identities = 19/46 (41%), Positives = 27/46 (58%), Gaps = 3/46 (6%) Frame = +3 Query: 540 DKTKNQRKGFCFITFES-EQVVNDLLKTPKRTIGGKE--VDVKRAT 668 D T + KGF F FES E ++ + +RTI G+E V+V +AT Sbjct: 237 DPTTKKPKGFGFYEFESAEGILRAIRLLTQRTIDGQELLVNVNQAT 282 >At1g60000.1 68414.m06759 29 kDa ribonucleoprotein, chloroplast, putative / RNA-binding protein cp29, putative similar to 29 kDa ribonucleoprotein chloroplast precursor {Nicotiana sylvestris} SP|Q08935, SP|Q08937; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) contains an AG-donor site at intron. Length = 258 Score = 29.1 bits (62), Expect = 3.3 Identities = 11/39 (28%), Positives = 21/39 (53%) Frame = +1 Query: 259 FGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVM 375 F G++ V D +TGRSRG+ F+ + + ++ + Sbjct: 197 FRECGDVVGARVVFDGDTGRSRGYGFVCYSSKAEMETAL 235 Score = 28.3 bits (60), Expect = 5.8 Identities = 25/88 (28%), Positives = 37/88 (42%), Gaps = 12/88 (13%) Frame = +1 Query: 280 ESINVKTDPNTGRSRGFAFIVFKAPE-------SIDKVMAAGEHTINNKKVDPKKAK--- 429 E + V + +TG+SRGFAF+ E ++D G N PK K Sbjct: 112 ELVEVLYNRDTGQSRGFAFVTMSNVEDCNIIIDNLDGTEYLGRALKVNFADKPKPNKEPL 171 Query: 430 --ARHGKIFVGGLSSEISDDEIRNFFSE 507 K+FVG LS ++ + + F E Sbjct: 172 YPETEHKLFVGNLSWTVTSESLAGAFRE 199 >At5g43960.2 68418.m05378 nuclear transport factor 2 (NTF2) family protein / RNA recognition motif (RRM)-containing protein contains Pfam profiles PF02136: Nuclear transport factor 2 (NTF2) domain, PF00076: RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Length = 391 Score = 28.7 bits (61), Expect = 4.4 Identities = 14/49 (28%), Positives = 24/49 (48%), Gaps = 2/49 (4%) Frame = +3 Query: 537 FDKTKNQRKGFC--FITFESEQVVNDLLKTPKRTIGGKEVDVKRATPKP 677 F +T+ G C F+ FE V + +K +GG++V ++ P P Sbjct: 289 FLRTRKDVMGVCYAFVEFEDMTSVENAIKASPIYLGGRQVYIEERRPNP 337 >At5g43960.1 68418.m05379 nuclear transport factor 2 (NTF2) family protein / RNA recognition motif (RRM)-containing protein contains Pfam profiles PF02136: Nuclear transport factor 2 (NTF2) domain, PF00076: RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Length = 450 Score = 28.7 bits (61), Expect = 4.4 Identities = 14/49 (28%), Positives = 24/49 (48%), Gaps = 2/49 (4%) Frame = +3 Query: 537 FDKTKNQRKGFC--FITFESEQVVNDLLKTPKRTIGGKEVDVKRATPKP 677 F +T+ G C F+ FE V + +K +GG++V ++ P P Sbjct: 348 FLRTRKDVMGVCYAFVEFEDMTSVENAIKASPIYLGGRQVYIEERRPNP 396 >At5g12440.1 68418.m01462 zinc finger (CCCH-type) family protein contains Pfam domain, PF00642: Zinc finger C-x8-C-x5-C-x3-H type (and similar) Length = 552 Score = 28.7 bits (61), Expect = 4.4 Identities = 18/65 (27%), Positives = 33/65 (50%), Gaps = 1/65 (1%) Frame = +1 Query: 256 HFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGE-HTINNKKVDPKKAKA 432 +F +G ++ + + + R F F+ F PE++ V+A G H I + +V K K Sbjct: 279 YFSLFGTVQDVRIPYQ----QKRMFGFVSFAHPETVKVVLARGNPHFICDSRVLVKPYKE 334 Query: 433 RHGKI 447 + GK+ Sbjct: 335 K-GKV 338 >At5g06000.1 68418.m00665 eukaryotic translation initiation factor 3G, putative / eIF3g, putative similar to eukaryotic translation initiation factor 3g [Arabidopsis thaliana] GI:12407751; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 276 Score = 28.7 bits (61), Expect = 4.4 Identities = 12/39 (30%), Positives = 19/39 (48%) Frame = +1 Query: 259 FGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVM 375 F +G + +V D T SRGF F+ F + E + + Sbjct: 194 FRPFGAVTRCHVAIDQKTSMSRGFGFVSFVSREDAQRAI 232 >At3g30820.1 68416.m03953 hypothetical protein Length = 405 Score = 28.7 bits (61), Expect = 4.4 Identities = 15/47 (31%), Positives = 24/47 (51%) Frame = +2 Query: 128 GNAENGGGDSQDHNSAEAPGRDDDRKLFVGGLSWETTDKELRVILEH 268 G A+ G ++ EAP DD K + G +W+ D ++ V L+H Sbjct: 2 GRAKAAAGTRARMSNTEAPTNDDPNKRPITG-TWDGMDTKMLVDLKH 47 >At5g59860.1 68418.m07506 RNA recognition motif (RRM)-containing protein similar to SP|Q14011 Cold-inducible RNA-binding protein (Glycine-rich RNA-binding protein CIRP) {Homo sapiens}; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 157 Score = 28.3 bits (60), Expect = 5.8 Identities = 16/43 (37%), Positives = 23/43 (53%), Gaps = 1/43 (2%) Frame = +3 Query: 540 DKTKNQRKGFCFITFESEQVVNDLLKTPK-RTIGGKEVDVKRA 665 D+ + KGF FITFESE LK + + G+ + V+ A Sbjct: 100 DQQTQRPKGFGFITFESEDDAQKALKALNGKIVNGRLIFVETA 142 >At4g27000.1 68417.m03884 RNA-binding protein 45 (RBP45), putative DNA binding protein ACBF - Nicotiana tabacum, PID:g1899188 Length = 415 Score = 28.3 bits (60), Expect = 5.8 Identities = 13/31 (41%), Positives = 18/31 (58%) Frame = +1 Query: 268 YGEIESINVKTDPNTGRSRGFAFIVFKAPES 360 Y ++ V D TGRS+G+ F+ F A ES Sbjct: 197 YSSVKGAKVVNDRTTGRSKGYGFVRF-ADES 226 >At3g55340.1 68416.m06146 RNA recognition motif (RRM)-containing protein low similarity to nucleolar phosphoprotein (Nopp52), Tetrahymena thermophila, EMBL:TT51555; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 597 Score = 28.3 bits (60), Expect = 5.8 Identities = 8/28 (28%), Positives = 19/28 (67%) Frame = +2 Query: 191 DDDRKLFVGGLSWETTDKELRVILEHTV 274 D ++++G L+W+TT++++R + V Sbjct: 259 DGYNRVYIGNLAWDTTERDIRKLFSDCV 286 Score = 27.9 bits (59), Expect = 7.7 Identities = 11/33 (33%), Positives = 21/33 (63%) Frame = +1 Query: 442 KIFVGGLSSEISDDEIRNFFSELELS*KWRCPL 540 K++VGG+ + ++DEIR++F + K C + Sbjct: 162 KLYVGGIPYQSTEDEIRSYFRSCGVIIKVDCKM 194 >At2g47390.1 68415.m05915 expressed protein Length = 961 Score = 28.3 bits (60), Expect = 5.8 Identities = 16/47 (34%), Positives = 23/47 (48%) Frame = +2 Query: 125 NGNAENGGGDSQDHNSAEAPGRDDDRKLFVGGLSWETTDKELRVILE 265 +G AE+GGG S SA A +DD G + E+R I++ Sbjct: 78 SGGAEDGGGTSNGSLSASATATEDDELAI--GTGYRLPPPEIRDIVD 122 >At5g22830.1 68418.m02669 magnesium transporter CorA-like family protein weak similarity to SP|Q01926 RNA splicing protein MRS2, mitochondrial precursor {Saccharomyces cerevisiae}; contains Pfam profile PF01544: CorA-like Mg2+ transporter protein; supporting cDNA gi|12007446|gb|AF322255.1|AF322255 Length = 459 Score = 27.9 bits (59), Expect = 7.7 Identities = 14/45 (31%), Positives = 23/45 (51%), Gaps = 1/45 (2%) Frame = +2 Query: 77 ANNDNFAQDITTDNQ-LNGNAENGGGDSQDHNSAEAPGRDDDRKL 208 A + A+D D + LN + ++ G DS + GRDD +K+ Sbjct: 65 AKSPTTAEDFVGDYESLNVSDDDDGSDSNSSDGDNGGGRDDSKKI 109 >At4g36690.3 68417.m05206 U2 snRNP auxiliary factor large subunit, putative similar to U2 snRNP auxiliary factor, large subunit [Nicotiana plumbaginifolia] GI:3850823 Length = 565 Score = 27.9 bits (59), Expect = 7.7 Identities = 12/39 (30%), Positives = 22/39 (56%) Frame = +1 Query: 265 AYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA 381 ++G ++ ++ D TG S+G+AF V++ D AA Sbjct: 381 SFGGLKGFDLVKDRETGNSKGYAFCVYQDLSVTDIACAA 419 >At4g36690.2 68417.m05207 U2 snRNP auxiliary factor large subunit, putative similar to U2 snRNP auxiliary factor, large subunit [Nicotiana plumbaginifolia] GI:3850823 Length = 542 Score = 27.9 bits (59), Expect = 7.7 Identities = 12/39 (30%), Positives = 22/39 (56%) Frame = +1 Query: 265 AYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA 381 ++G ++ ++ D TG S+G+AF V++ D AA Sbjct: 381 SFGGLKGFDLVKDRETGNSKGYAFCVYQDLSVTDIACAA 419 >At4g36690.1 68417.m05205 U2 snRNP auxiliary factor large subunit, putative similar to U2 snRNP auxiliary factor, large subunit [Nicotiana plumbaginifolia] GI:3850823 Length = 573 Score = 27.9 bits (59), Expect = 7.7 Identities = 12/39 (30%), Positives = 22/39 (56%) Frame = +1 Query: 265 AYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA 381 ++G ++ ++ D TG S+G+AF V++ D AA Sbjct: 381 SFGGLKGFDLVKDRETGNSKGYAFCVYQDLSVTDIACAA 419 >At1g16610.2 68414.m01990 arginine/serine-rich protein, putative (SR45) similar to arginine/serine-rich protein GI:6601502 from [Arabidopsis thaliana] Length = 407 Score = 27.9 bits (59), Expect = 7.7 Identities = 15/58 (25%), Positives = 27/58 (46%) Frame = +1 Query: 259 FGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKVDPKKAKA 432 FG +GE+ + + D RG ++ FKA +K + ++ ++D K KA Sbjct: 118 FGNFGEVIHVEIAMDRAVNLPRGHGYVEFKARADAEK----AQLYMDGAQIDGKVVKA 171 >At1g16610.1 68414.m01989 arginine/serine-rich protein, putative (SR45) similar to arginine/serine-rich protein GI:6601502 from [Arabidopsis thaliana] Length = 414 Score = 27.9 bits (59), Expect = 7.7 Identities = 15/58 (25%), Positives = 27/58 (46%) Frame = +1 Query: 259 FGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKVDPKKAKA 432 FG +GE+ + + D RG ++ FKA +K + ++ ++D K KA Sbjct: 118 FGNFGEVIHVEIAMDRAVNLPRGHGYVEFKARADAEK----AQLYMDGAQIDGKVVKA 171 >At1g03457.2 68414.m00327 RNA-binding protein, putative similar to Etr-1 [Danio rerio] GI:7670536, BRUNO-like 6 RNA-binding protein [Homo sapiens] GI:15341327; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 438 Score = 27.9 bits (59), Expect = 7.7 Identities = 26/104 (25%), Positives = 43/104 (41%), Gaps = 21/104 (20%) Frame = +1 Query: 259 FGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKV-----DPKK 423 F + + +N+ + T RG F+ E DKV+ ++ +NKK P + Sbjct: 32 FREFSIVNEVNIIKEKTTRAPRGCCFLTCPTREDADKVI----NSFHNKKTLPGASSPLQ 87 Query: 424 AKARHG----------------KIFVGGLSSEISDDEIRNFFSE 507 K G K+FVG L +S+ E+++ FSE Sbjct: 88 VKYADGELERLDVLDCSCNPEHKLFVGMLPKNVSETEVQSLFSE 131 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,901,810 Number of Sequences: 28952 Number of extensions: 336407 Number of successful extensions: 1573 Number of sequences better than 10.0: 151 Number of HSP's better than 10.0 without gapping: 1142 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1556 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1672953192 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -