BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30962 (726 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY390608-1|AAR27305.1| 242|Anopheles gambiae SP22D protein. 25 2.4 AY390607-1|AAR27304.1| 242|Anopheles gambiae SP22D protein. 25 2.4 AY390606-1|AAR27303.1| 241|Anopheles gambiae SP22D protein. 25 2.4 AY390605-1|AAR27302.1| 241|Anopheles gambiae SP22D protein. 25 2.4 AY390604-1|AAR27301.1| 241|Anopheles gambiae SP22D protein. 25 2.4 AY390603-1|AAR27300.1| 241|Anopheles gambiae SP22D protein. 25 2.4 AJ276428-1|CAB81934.1| 1322|Anopheles gambiae adhesive serine pr... 25 2.4 AF117751-1|AAD38337.3| 1322|Anopheles gambiae serine protease 22... 25 2.4 U89799-1|AAD03792.1| 332|Anopheles gambiae Tc1-like transposase... 25 3.2 U89800-1|AAD03793.1| 260|Anopheles gambiae Tc1-like transposase... 24 4.2 EF595743-1|ABQ88369.1| 1893|Anopheles gambiae voltage-gated calc... 24 5.5 >AY390608-1|AAR27305.1| 242|Anopheles gambiae SP22D protein. Length = 242 Score = 25.0 bits (52), Expect = 2.4 Identities = 10/30 (33%), Positives = 17/30 (56%) Frame = +1 Query: 226 LLECPEFPSVFSELSDFFDCSWGTLFKSNT 315 +++C +F S + +C+ GTLF NT Sbjct: 123 VMDCRQFLSCWKGRGFILNCAPGTLFNPNT 152 >AY390607-1|AAR27304.1| 242|Anopheles gambiae SP22D protein. Length = 242 Score = 25.0 bits (52), Expect = 2.4 Identities = 10/30 (33%), Positives = 17/30 (56%) Frame = +1 Query: 226 LLECPEFPSVFSELSDFFDCSWGTLFKSNT 315 +++C +F S + +C+ GTLF NT Sbjct: 123 VMDCRQFLSCWKGRGFILNCAPGTLFNPNT 152 >AY390606-1|AAR27303.1| 241|Anopheles gambiae SP22D protein. Length = 241 Score = 25.0 bits (52), Expect = 2.4 Identities = 10/30 (33%), Positives = 17/30 (56%) Frame = +1 Query: 226 LLECPEFPSVFSELSDFFDCSWGTLFKSNT 315 +++C +F S + +C+ GTLF NT Sbjct: 122 VMDCRQFLSCWKGRGYILNCAPGTLFNPNT 151 >AY390605-1|AAR27302.1| 241|Anopheles gambiae SP22D protein. Length = 241 Score = 25.0 bits (52), Expect = 2.4 Identities = 10/30 (33%), Positives = 17/30 (56%) Frame = +1 Query: 226 LLECPEFPSVFSELSDFFDCSWGTLFKSNT 315 +++C +F S + +C+ GTLF NT Sbjct: 122 VMDCRQFLSCWKGRGFILNCAPGTLFNPNT 151 >AY390604-1|AAR27301.1| 241|Anopheles gambiae SP22D protein. Length = 241 Score = 25.0 bits (52), Expect = 2.4 Identities = 10/30 (33%), Positives = 17/30 (56%) Frame = +1 Query: 226 LLECPEFPSVFSELSDFFDCSWGTLFKSNT 315 +++C +F S + +C+ GTLF NT Sbjct: 122 VMDCRQFLSCWKGRGFILNCAPGTLFNPNT 151 >AY390603-1|AAR27300.1| 241|Anopheles gambiae SP22D protein. Length = 241 Score = 25.0 bits (52), Expect = 2.4 Identities = 10/30 (33%), Positives = 17/30 (56%) Frame = +1 Query: 226 LLECPEFPSVFSELSDFFDCSWGTLFKSNT 315 +++C +F S + +C+ GTLF NT Sbjct: 122 VMDCRQFLSCWKGRGFILNCAPGTLFNPNT 151 >AJ276428-1|CAB81934.1| 1322|Anopheles gambiae adhesive serine protease protein. Length = 1322 Score = 25.0 bits (52), Expect = 2.4 Identities = 10/30 (33%), Positives = 17/30 (56%) Frame = +1 Query: 226 LLECPEFPSVFSELSDFFDCSWGTLFKSNT 315 +++C +F S + +C+ GTLF NT Sbjct: 194 VMDCRQFLSCWKGRGFILNCAPGTLFNPNT 223 >AF117751-1|AAD38337.3| 1322|Anopheles gambiae serine protease 22D protein. Length = 1322 Score = 25.0 bits (52), Expect = 2.4 Identities = 10/30 (33%), Positives = 17/30 (56%) Frame = +1 Query: 226 LLECPEFPSVFSELSDFFDCSWGTLFKSNT 315 +++C +F S + +C+ GTLF NT Sbjct: 193 VMDCRQFLSCWKGRGFILNCAPGTLFNPNT 222 >U89799-1|AAD03792.1| 332|Anopheles gambiae Tc1-like transposase protein. Length = 332 Score = 24.6 bits (51), Expect = 3.2 Identities = 8/20 (40%), Positives = 14/20 (70%) Frame = -1 Query: 327 KRLHGVGFKKRAPRAIKEIR 268 +RLH GF R PR +++++ Sbjct: 96 RRLHAAGFCARRPRKVRKLQ 115 >U89800-1|AAD03793.1| 260|Anopheles gambiae Tc1-like transposase protein. Length = 260 Score = 24.2 bits (50), Expect = 4.2 Identities = 8/19 (42%), Positives = 13/19 (68%) Frame = -1 Query: 327 KRLHGVGFKKRAPRAIKEI 271 +RLH GF R PR ++++ Sbjct: 24 RRLHAAGFCARRPRKVRKL 42 >EF595743-1|ABQ88369.1| 1893|Anopheles gambiae voltage-gated calcium channel alpha1 subunit protein. Length = 1893 Score = 23.8 bits (49), Expect = 5.5 Identities = 12/20 (60%), Positives = 12/20 (60%) Frame = -3 Query: 679 CRERSETPVTGITFFDLFGL 620 CR E P GIT FD FGL Sbjct: 307 CRYYWEGPNFGITNFDNFGL 326 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 706,831 Number of Sequences: 2352 Number of extensions: 13554 Number of successful extensions: 21 Number of sequences better than 10.0: 11 Number of HSP's better than 10.0 without gapping: 19 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 21 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 74012934 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -