BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30959 (748 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ301655-1|CAC35008.1| 1433|Anopheles gambiae putative epidermal... 31 0.038 AF395079-1|AAK97461.1| 371|Anopheles gambiae basic helix-loop-h... 28 0.35 AJ439353-8|CAD27930.1| 1039|Anopheles gambiae putative DNA topoi... 27 0.61 AY263175-1|AAP78790.1| 814|Anopheles gambiae TmcA-like protein ... 25 1.9 DQ219483-1|ABB29887.1| 961|Anopheles gambiae cryptochrome 2 pro... 25 2.5 DQ303468-1|ABC18327.1| 1115|Anopheles gambiae putative methopren... 24 5.7 AJ010299-1|CAA09070.1| 722|Anopheles gambiae stat protein. 24 5.7 AB090813-1|BAC57901.1| 724|Anopheles gambiae gag-like protein p... 24 5.7 CR954256-4|CAJ14145.1| 1494|Anopheles gambiae tensin protein. 23 7.6 AY578799-1|AAT07304.1| 679|Anopheles gambiae brinker protein. 23 7.6 AF444783-1|AAL37904.1| 1356|Anopheles gambiae Trex protein. 23 7.6 >AJ301655-1|CAC35008.1| 1433|Anopheles gambiae putative epidermal growth factor receptorprotein. Length = 1433 Score = 31.1 bits (67), Expect = 0.038 Identities = 15/42 (35%), Positives = 19/42 (45%) Frame = -2 Query: 132 QLLQTKQNTQHSIQQQPSLVHNHQHEPVRQDHQG*VCHNGDT 7 Q Q +Q QH QQ L H+HQ + + H H G T Sbjct: 1312 QQQQQQQQQQHQQHQQHQLQHHHQPQLSQSSHHSSSSHGGPT 1353 Score = 25.8 bits (54), Expect = 1.4 Identities = 21/64 (32%), Positives = 28/64 (43%), Gaps = 1/64 (1%) Frame = -2 Query: 222 NGIVAGKHEH*GLPHVQRICLPKFCLPH-YCQLLQTKQNTQHSIQQQPSLVHNHQHEPVR 46 NG+ +H L +Q+ P L H Y Q LQ +Q Q QQQ HQ ++ Sbjct: 1278 NGMPTHQHSQIQLQPIQQ---PLQTLQHQYQQQLQQQQQQQQQQQQQHQ---QHQQHQLQ 1331 Query: 45 QDHQ 34 HQ Sbjct: 1332 HHHQ 1335 >AF395079-1|AAK97461.1| 371|Anopheles gambiae basic helix-loop-helix transcriptionfactor ASH protein. Length = 371 Score = 27.9 bits (59), Expect = 0.35 Identities = 13/29 (44%), Positives = 16/29 (55%) Frame = -2 Query: 120 TKQNTQHSIQQQPSLVHNHQHEPVRQDHQ 34 T N QQQ H+HQH+P +Q HQ Sbjct: 296 TDNNNYILAQQQQQQHHHHQHQP-QQQHQ 323 >AJ439353-8|CAD27930.1| 1039|Anopheles gambiae putative DNA topoisomerase protein. Length = 1039 Score = 27.1 bits (57), Expect = 0.61 Identities = 12/33 (36%), Positives = 17/33 (51%) Frame = -2 Query: 141 HYCQLLQTKQNTQHSIQQQPSLVHNHQHEPVRQ 43 HY L Q +Q + QQ ++ H HQ + RQ Sbjct: 604 HYLPLQQQQQQQARHLPQQQAIHHIHQQQYPRQ 636 >AY263175-1|AAP78790.1| 814|Anopheles gambiae TmcA-like protein protein. Length = 814 Score = 25.4 bits (53), Expect = 1.9 Identities = 22/68 (32%), Positives = 34/68 (50%), Gaps = 6/68 (8%) Frame = -3 Query: 248 FQIRIENSKMELLQESMNIKAYLMFKEFVFQSFVSH---IIASSFKQSRIL---SIVFSN 87 F I + +LL+E N+ YL+ E + SH ++AS F R L +IV S Sbjct: 109 FNIFLTTKWQQLLRELANLATYLIPWESRIKEIESHFGSVVASYFTFLRWLFSVNIVISV 168 Query: 86 SLHLFIII 63 L +FI++ Sbjct: 169 LLVVFIMV 176 >DQ219483-1|ABB29887.1| 961|Anopheles gambiae cryptochrome 2 protein. Length = 961 Score = 25.0 bits (52), Expect = 2.5 Identities = 13/37 (35%), Positives = 15/37 (40%) Frame = -2 Query: 144 PHYCQLLQTKQNTQHSIQQQPSLVHNHQHEPVRQDHQ 34 P +LL QH QQQ QHE +Q Q Sbjct: 888 PESHKLLAENYRQQHQQQQQQQQQQQQQHEHEQQQQQ 924 >DQ303468-1|ABC18327.1| 1115|Anopheles gambiae putative methoprene-tolerant protein protein. Length = 1115 Score = 23.8 bits (49), Expect = 5.7 Identities = 10/19 (52%), Positives = 10/19 (52%) Frame = -2 Query: 93 QQQPSLVHNHQHEPVRQDH 37 QQQPS H QH Q H Sbjct: 166 QQQPSSYHQQQHPGHSQHH 184 >AJ010299-1|CAA09070.1| 722|Anopheles gambiae stat protein. Length = 722 Score = 23.8 bits (49), Expect = 5.7 Identities = 12/30 (40%), Positives = 16/30 (53%) Frame = -2 Query: 618 FKSVFTLNYRLMTSFKSTLMLPSFFKIHCN 529 F+S FTL +T TL LP+ +H N Sbjct: 403 FQSSFTLEQEELTVTVWTLSLPAVVIVHVN 432 >AB090813-1|BAC57901.1| 724|Anopheles gambiae gag-like protein protein. Length = 724 Score = 23.8 bits (49), Expect = 5.7 Identities = 12/33 (36%), Positives = 15/33 (45%) Frame = -2 Query: 132 QLLQTKQNTQHSIQQQPSLVHNHQHEPVRQDHQ 34 QL Q +Q QH QQQ Q + +Q Q Sbjct: 301 QLRQQRQQQQHQQQQQQQQQQRQQQQRQQQRQQ 333 >CR954256-4|CAJ14145.1| 1494|Anopheles gambiae tensin protein. Length = 1494 Score = 23.4 bits (48), Expect = 7.6 Identities = 10/29 (34%), Positives = 10/29 (34%) Frame = -2 Query: 123 QTKQNTQHSIQQQPSLVHNHQHEPVRQDH 37 Q T H QQP HQH H Sbjct: 634 QKADQTDHHQSQQPQQQQQHQHHHHHHHH 662 >AY578799-1|AAT07304.1| 679|Anopheles gambiae brinker protein. Length = 679 Score = 23.4 bits (48), Expect = 7.6 Identities = 15/57 (26%), Positives = 23/57 (40%) Frame = -2 Query: 201 HEH*GLPHVQRICLPKFCLPHYCQLLQTKQNTQHSIQQQPSLVHNHQHEPVRQDHQG 31 H+H LPHVQ+ H+ + + H + +H+H H P H G Sbjct: 123 HQHPHLPHVQQ---------HHPSVHHPAHHPLHYQPAAAAAMHHHHHHP-HHHHPG 169 >AF444783-1|AAL37904.1| 1356|Anopheles gambiae Trex protein. Length = 1356 Score = 23.4 bits (48), Expect = 7.6 Identities = 11/33 (33%), Positives = 16/33 (48%) Frame = -2 Query: 132 QLLQTKQNTQHSIQQQPSLVHNHQHEPVRQDHQ 34 QL +++Q Q QQQ Q + +Q HQ Sbjct: 1295 QLHRSQQQQQQQQQQQQQQQQQQQQQQQQQQHQ 1327 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 772,286 Number of Sequences: 2352 Number of extensions: 15580 Number of successful extensions: 56 Number of sequences better than 10.0: 11 Number of HSP's better than 10.0 without gapping: 44 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 55 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 76923555 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -