BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30958 (654 letters) Database: fruitfly 53,049 sequences; 24,988,368 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value X69974-1|CAA49594.1| 302|Drosophila melanogaster serine /threon... 28 9.6 X15583-1|CAA33609.1| 302|Drosophila melanogaster protein ( Frui... 28 9.6 S47852-1|AAB23957.1| 302|Drosophila melanogaster protein phosph... 28 9.6 AY061063-1|AAL28611.1| 302|Drosophila melanogaster LD03380p pro... 28 9.6 AY060272-1|AAL25311.1| 302|Drosophila melanogaster GH10637p pro... 28 9.6 AE014298-2139|AAF48448.1| 302|Drosophila melanogaster CG9156-PA... 28 9.6 AE014297-1518|AAF54810.1| 302|Drosophila melanogaster CG5650-PA... 28 9.6 >X69974-1|CAA49594.1| 302|Drosophila melanogaster serine /threonine specific proteinphosphatase protein. Length = 302 Score = 28.3 bits (60), Expect = 9.6 Identities = 16/37 (43%), Positives = 21/37 (56%), Gaps = 3/37 (8%) Frame = +3 Query: 138 FLGSVLFHVRRDIETICLLTVMKTKTSP---LLQTNH 239 FLG + ++ +ETICLL K K S LL+ NH Sbjct: 87 FLGDYVDRGKQSLETICLLLAYKIKYSENFFLLRGNH 123 >X15583-1|CAA33609.1| 302|Drosophila melanogaster protein ( Fruitfly mRNA for proteinphosphatase 1 alpha. ). Length = 302 Score = 28.3 bits (60), Expect = 9.6 Identities = 16/37 (43%), Positives = 21/37 (56%), Gaps = 3/37 (8%) Frame = +3 Query: 138 FLGSVLFHVRRDIETICLLTVMKTKTSP---LLQTNH 239 FLG + ++ +ETICLL K K S LL+ NH Sbjct: 87 FLGDYVDRGKQSLETICLLLAYKIKYSENFFLLRGNH 123 >S47852-1|AAB23957.1| 302|Drosophila melanogaster protein phosphatase 1 catalyticsubunit 87B protein. Length = 302 Score = 28.3 bits (60), Expect = 9.6 Identities = 16/37 (43%), Positives = 21/37 (56%), Gaps = 3/37 (8%) Frame = +3 Query: 138 FLGSVLFHVRRDIETICLLTVMKTKTSP---LLQTNH 239 FLG + ++ +ETICLL K K S LL+ NH Sbjct: 87 FLGDYVDRGKQSLETICLLLAYKIKYSENFFLLRGNH 123 >AY061063-1|AAL28611.1| 302|Drosophila melanogaster LD03380p protein. Length = 302 Score = 28.3 bits (60), Expect = 9.6 Identities = 16/37 (43%), Positives = 21/37 (56%), Gaps = 3/37 (8%) Frame = +3 Query: 138 FLGSVLFHVRRDIETICLLTVMKTKTSP---LLQTNH 239 FLG + ++ +ETICLL K K S LL+ NH Sbjct: 87 FLGDYVDRGKQSLETICLLLAYKIKYSENFFLLRGNH 123 >AY060272-1|AAL25311.1| 302|Drosophila melanogaster GH10637p protein. Length = 302 Score = 28.3 bits (60), Expect = 9.6 Identities = 16/37 (43%), Positives = 21/37 (56%), Gaps = 3/37 (8%) Frame = +3 Query: 138 FLGSVLFHVRRDIETICLLTVMKTKTSP---LLQTNH 239 FLG + ++ +ETICLL K K S LL+ NH Sbjct: 87 FLGDYVDRGKQSLETICLLLAYKIKYSENFFLLRGNH 123 >AE014298-2139|AAF48448.1| 302|Drosophila melanogaster CG9156-PA protein. Length = 302 Score = 28.3 bits (60), Expect = 9.6 Identities = 16/37 (43%), Positives = 21/37 (56%), Gaps = 3/37 (8%) Frame = +3 Query: 138 FLGSVLFHVRRDIETICLLTVMKTKTSP---LLQTNH 239 FLG + ++ +ETICLL K K S LL+ NH Sbjct: 87 FLGDYVDRGKQSLETICLLLAYKIKYSENFFLLRGNH 123 >AE014297-1518|AAF54810.1| 302|Drosophila melanogaster CG5650-PA protein. Length = 302 Score = 28.3 bits (60), Expect = 9.6 Identities = 16/37 (43%), Positives = 21/37 (56%), Gaps = 3/37 (8%) Frame = +3 Query: 138 FLGSVLFHVRRDIETICLLTVMKTKTSP---LLQTNH 239 FLG + ++ +ETICLL K K S LL+ NH Sbjct: 87 FLGDYVDRGKQSLETICLLLAYKIKYSENFFLLRGNH 123 Database: fruitfly Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 24,988,368 Number of sequences in database: 53,049 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 24,647,886 Number of Sequences: 53049 Number of extensions: 456435 Number of successful extensions: 980 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 966 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 980 length of database: 24,988,368 effective HSP length: 82 effective length of database: 20,638,350 effective search space used: 2786177250 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -