BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30957 (713 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U42833-6|AAA83581.1| 1650|Caenorhabditis elegans Hypothetical pr... 29 2.5 AL117202-20|CAB57898.4| 1205|Caenorhabditis elegans Hypothetical... 29 4.4 AF125463-6|AAD12865.1| 301|Caenorhabditis elegans Hypothetical ... 29 4.4 AC024810-8|AAU20830.1| 1446|Caenorhabditis elegans Hypothetical ... 28 7.6 >U42833-6|AAA83581.1| 1650|Caenorhabditis elegans Hypothetical protein ZK430.1 protein. Length = 1650 Score = 29.5 bits (63), Expect = 2.5 Identities = 12/37 (32%), Positives = 23/37 (62%) Frame = +3 Query: 540 DGELANEIVRERCIKFLSSKIQQLGREIINKEAEELI 650 D E AN++ E + F+ S +++ E +NK+ E+L+ Sbjct: 63 DTEFANDLFSEERVDFVRSMLEKGANEELNKQIEKLL 99 >AL117202-20|CAB57898.4| 1205|Caenorhabditis elegans Hypothetical protein Y47D3A.26 protein. Length = 1205 Score = 28.7 bits (61), Expect = 4.4 Identities = 14/35 (40%), Positives = 23/35 (65%), Gaps = 2/35 (5%) Frame = +2 Query: 89 HKKMAGDNI--EKLYKNYDILAAAKDEISQHEKEY 187 H+K A +N+ +KLYK + L A D+IS +E+ + Sbjct: 827 HRKNAIENLLTKKLYKTKESLTARVDDISDNERRH 861 >AF125463-6|AAD12865.1| 301|Caenorhabditis elegans Hypothetical protein Y49F6C.3 protein. Length = 301 Score = 28.7 bits (61), Expect = 4.4 Identities = 10/20 (50%), Positives = 17/20 (85%) Frame = +3 Query: 561 IVRERCIKFLSSKIQQLGRE 620 +V E+C++FLS K ++LGR+ Sbjct: 228 VVIEKCVEFLSDKSEKLGRD 247 >AC024810-8|AAU20830.1| 1446|Caenorhabditis elegans Hypothetical protein Y54E10A.11 protein. Length = 1446 Score = 27.9 bits (59), Expect = 7.6 Identities = 15/39 (38%), Positives = 21/39 (53%), Gaps = 1/39 (2%) Frame = +3 Query: 576 CIKFLSSKIQQLGREIINKEAEELIYHRMQKNFR-GCCC 689 C+KFL ++QQL E+ E + +QK GCCC Sbjct: 821 CLKFLDEELQQLRIEL---EKRVIKSEEIQKLINDGCCC 856 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,363,549 Number of Sequences: 27780 Number of extensions: 315337 Number of successful extensions: 875 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 851 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 875 length of database: 12,740,198 effective HSP length: 79 effective length of database: 10,545,578 effective search space used: 1666201324 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -