BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30952X (473 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AF084556-1|AAC71015.1| 652|Apis mellifera pipsqueak protein. 24 0.95 DQ288391-1|ABC41341.1| 630|Apis mellifera vasa protein protein. 22 3.8 AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. 21 5.1 AB022908-1|BAA86909.1| 493|Apis mellifera amylase protein. 21 6.7 AY242387-1|AAO72539.2| 693|Apis mellifera prophenoloxidase prot... 21 8.9 AB253416-1|BAE86927.1| 580|Apis mellifera alpha-glucosidase pro... 21 8.9 >AF084556-1|AAC71015.1| 652|Apis mellifera pipsqueak protein. Length = 652 Score = 23.8 bits (49), Expect = 0.95 Identities = 8/20 (40%), Positives = 14/20 (70%) Frame = +3 Query: 24 NARLLHYS*TYNSVFGRLER 83 N +HY+ Y+S++GR +R Sbjct: 592 NQAAIHYNLPYSSLYGRFKR 611 >DQ288391-1|ABC41341.1| 630|Apis mellifera vasa protein protein. Length = 630 Score = 21.8 bits (44), Expect = 3.8 Identities = 9/27 (33%), Positives = 15/27 (55%) Frame = +3 Query: 81 RCNEPRVDVRKTGDFTIVSNGLAVSRG 161 +CN+ + D+ +TG +G SRG Sbjct: 67 QCNDKKTDIEETGRGKGRGHGKGGSRG 93 >AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. Length = 1598 Score = 21.4 bits (43), Expect = 5.1 Identities = 7/14 (50%), Positives = 11/14 (78%) Frame = -3 Query: 264 GSNVLPARQVRKRR 223 G+ +P R++RKRR Sbjct: 257 GTTTIPTRRLRKRR 270 >AB022908-1|BAA86909.1| 493|Apis mellifera amylase protein. Length = 493 Score = 21.0 bits (42), Expect = 6.7 Identities = 10/32 (31%), Positives = 17/32 (53%), Gaps = 1/32 (3%) Frame = -2 Query: 382 PSIGS-NVLEPSLSSKMSTTTCNCNSRDRVVY 290 P+ G+ N+L PS+ + + C R R +Y Sbjct: 357 PNDGNGNILSPSIHDNICSNGWICEHRWRQIY 388 >AY242387-1|AAO72539.2| 693|Apis mellifera prophenoloxidase protein. Length = 693 Score = 20.6 bits (41), Expect = 8.9 Identities = 11/24 (45%), Positives = 14/24 (58%) Frame = -2 Query: 94 GSLHLSKRPKTLLYVHE*CNKRAF 23 G L+L RP +YV + NK AF Sbjct: 7 GILYLFDRPSEPVYVPKGDNKVAF 30 >AB253416-1|BAE86927.1| 580|Apis mellifera alpha-glucosidase protein. Length = 580 Score = 20.6 bits (41), Expect = 8.9 Identities = 7/17 (41%), Positives = 12/17 (70%) Frame = -1 Query: 236 YENDVLFFIYNRQFNDA 186 Y+N +++ IY R F D+ Sbjct: 27 YKNALVYQIYPRSFQDS 43 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 117,976 Number of Sequences: 438 Number of extensions: 2160 Number of successful extensions: 6 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 146,343 effective HSP length: 53 effective length of database: 123,129 effective search space used: 12805416 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -