BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30950 (304 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 01_06_1111 - 34599014-34599215,34599378-34599497,34599654-345997... 39 7e-04 05_04_0043 + 17450999-17451181,17451353-17451416,17451642-174517... 39 9e-04 09_04_0702 - 19587943-19588168,19588423-19588525,19588809-195889... 38 0.002 05_04_0044 + 17470457-17470613,17470696-17470789,17471069-174711... 38 0.002 01_06_1110 - 34582267-34582468,34582732-34582819,34589337-345894... 37 0.003 06_03_1162 + 28093749-28093851,28093939-28093997,28094691-280947... 36 0.006 10_05_0036 + 8443957-8444112,8446063-8446129,8446685-8446743,844... 35 0.011 01_07_0064 + 40834649-40834786,40834934-40834997,40835333-408353... 35 0.011 09_04_0703 - 19614057-19614264,19615305-19615407,19615880-196159... 33 0.057 04_04_0495 - 25623562-25623775,25623902-25624004,25624129-256242... 31 0.13 04_04_0496 + 25631832-25631972,25632094-25632160,25634993-256350... 31 0.23 03_02_0139 - 5844107-5844278,5844413-5844521,5844630-5844732,584... 30 0.30 07_03_1537 + 27562097-27562340,27562436-27562494,27562605-275626... 30 0.40 05_04_0039 + 17421826-17421966,17422105-17422168,17422562-174226... 28 1.2 05_04_0036 + 17386160-17386318,17386588-17386651,17387089-173871... 28 1.2 04_04_0219 - 23703579-23703747,23703836-23703944,23704170-237042... 28 1.6 08_01_0869 + 8487518-8487697,8487792-8488127,8488211-8488410,848... 27 2.1 04_04_0221 - 23710739-23710964,23711050-23711158,23711371-237114... 27 2.1 04_04_0498 - 25654988-25655168,25658149-25658257,25658376-256584... 27 2.8 04_04_0216 - 23691007-23691187,23691273-23691381,23691627-236917... 27 2.8 01_05_0062 + 17755460-17755522,17756878-17756953,17757074-177571... 27 2.8 03_05_0833 - 28045442-28045881,28045961-28046063,28046172-280462... 27 3.7 01_06_1668 + 38998348-38998434,38999234-38999300,38999377-389994... 27 3.7 01_01_0850 - 6641980-6642163,6642791-6644091 27 3.7 04_04_0223 - 23723055-23723223,23723316-23723424,23723588-237236... 26 4.9 05_04_0038 + 17403620-17403769,17403975-17404038,17404807-174048... 25 8.6 01_01_0201 + 1746088-1747086,1748735-1748806,1750106-1750168,175... 25 8.6 >01_06_1111 - 34599014-34599215,34599378-34599497,34599654-34599760, 34600452-34600480,34600768-34600982,34601215-34601330, 34601960-34602218,34602342-34602429,34602932-34603003, 34603080-34603155,34603579-34603637,34603937-34604000, 34604104-34604232 Length = 511 Score = 39.1 bits (87), Expect = 7e-04 Identities = 18/39 (46%), Positives = 24/39 (61%) Frame = +1 Query: 1 GYVSRFGLYLVDFESPNKTRTAKDSAKLYSKVIASRRLP 117 GY +R+GLY VDF+ R AK SA+ Y + S+R P Sbjct: 467 GYQTRYGLYRVDFDDAALPRRAKRSARWYRDFLKSKRQP 505 >05_04_0043 + 17450999-17451181,17451353-17451416,17451642-17451700, 17452331-17452406,17452469-17452597,17453524-17453611, 17453711-17453966,17454308-17454423,17454569-17454789, 17454977-17455005,17455167-17455273,17455778-17456015 Length = 521 Score = 38.7 bits (86), Expect = 9e-04 Identities = 19/33 (57%), Positives = 21/33 (63%) Frame = +1 Query: 1 GYVSRFGLYLVDFESPNKTRTAKDSAKLYSKVI 99 GY S FGL+ VDFE PN R K SA YSK + Sbjct: 465 GYHSPFGLHYVDFEDPNLPRQPKLSAHWYSKFL 497 >09_04_0702 - 19587943-19588168,19588423-19588525,19588809-19588923, 19589061-19589086,19589178-19589398,19589493-19589608, 19589695-19589953,19590052-19590139,19590236-19590307, 19590401-19590476,19590746-19590809,19591139-19591259, 19592391-19592451,19592682-19592828 Length = 564 Score = 37.9 bits (84), Expect = 0.002 Identities = 17/30 (56%), Positives = 21/30 (70%) Frame = +1 Query: 1 GYVSRFGLYLVDFESPNKTRTAKDSAKLYS 90 GY RFGLY VDF SP +TR + SA+ Y+ Sbjct: 512 GYRLRFGLYGVDFASPERTRYQRHSARWYA 541 >05_04_0044 + 17470457-17470613,17470696-17470789,17471069-17471132, 17471378-17471477,17472027-17472085,17472572-17472647, 17472761-17472832,17473788-17473932,17474044-17474299, 17475190-17475305,17475503-17475723,17475996-17476024, 17476622-17476740,17476828-17477023,17477242-17477250 Length = 570 Score = 37.9 bits (84), Expect = 0.002 Identities = 19/35 (54%), Positives = 23/35 (65%) Frame = +1 Query: 1 GYVSRFGLYLVDFESPNKTRTAKDSAKLYSKVIAS 105 GY S FGL+ VDFE P+ R K SA+ YSK + S Sbjct: 525 GYHSPFGLHHVDFEDPSLPRQPKLSAQWYSKFLRS 559 >01_06_1110 - 34582267-34582468,34582732-34582819,34589337-34589439, 34589886-34589914,34590114-34590144,34590621-34590822, 34591424-34591539,34591784-34592006,34592151-34592238, 34592336-34592407,34592485-34592560,34593822-34593880, 34595341-34595404,34595487-34595618 Length = 494 Score = 36.7 bits (81), Expect = 0.003 Identities = 17/39 (43%), Positives = 24/39 (61%) Frame = +1 Query: 1 GYVSRFGLYLVDFESPNKTRTAKDSAKLYSKVIASRRLP 117 GY SR GLY VDF+ + R A+ SA+ YS + ++ P Sbjct: 450 GYQSRSGLYRVDFDDGARPRRARRSARWYSDFLKGKKDP 488 >06_03_1162 + 28093749-28093851,28093939-28093997,28094691-28094766, 28094848-28094919,28095023-28095110,28095230-28095485, 28095583-28095698,28096064-28096127,28096252-28096354, 28096446-28096554,28097048-28097234 Length = 410 Score = 35.9 bits (79), Expect = 0.006 Identities = 16/36 (44%), Positives = 25/36 (69%) Frame = +1 Query: 1 GYVSRFGLYLVDFESPNKTRTAKDSAKLYSKVIASR 108 GY RFGLY +D+++ N TR K S + +S+V+A + Sbjct: 372 GYTVRFGLYYIDYKN-NLTRIPKASVQWFSQVLAQK 406 >10_05_0036 + 8443957-8444112,8446063-8446129,8446685-8446743, 8446855-8446930,8447118-8447189,8447326-8447413, 8447489-8447744,8447934-8448049,8448247-8448470, 8448685-8448716,8448882-8449018,8449200-8449289, 8449383-8449557 Length = 515 Score = 35.1 bits (77), Expect = 0.011 Identities = 16/35 (45%), Positives = 24/35 (68%) Frame = +1 Query: 1 GYVSRFGLYLVDFESPNKTRTAKDSAKLYSKVIAS 105 GY SRFGLY VD++ N+ R K+S + + ++AS Sbjct: 481 GYTSRFGLYYVDYK--NRKRYPKNSVQWFKNLLAS 513 >01_07_0064 + 40834649-40834786,40834934-40834997,40835333-40835391, 40835602-40835677,40835775-40835846,40837641-40837728, 40838239-40838497,40838766-40839000,40839447-40839470, 40839910-40839997,40840110-40840300,40841082-40841322, 40841803-40842556 Length = 762 Score = 35.1 bits (77), Expect = 0.011 Identities = 16/41 (39%), Positives = 24/41 (58%) Frame = +1 Query: 1 GYVSRFGLYLVDFESPNKTRTAKDSAKLYSKVIASRRLPED 123 GY +GLY VDF ++ R A+ SA+ YS + +R + D Sbjct: 390 GYGQSYGLYRVDFADESRPRQARLSARWYSGFLKNREMDVD 430 >09_04_0703 - 19614057-19614264,19615305-19615407,19615880-19615973, 19616216-19616229,19616384-19616595,19617653-19617940, 19618275-19618362,19618444-19618515,19618597-19618672, 19618755-19618813,19618953-19619016,19619253-19619402 Length = 475 Score = 32.7 bits (71), Expect = 0.057 Identities = 19/41 (46%), Positives = 24/41 (58%), Gaps = 1/41 (2%) Frame = +1 Query: 1 GYVSRFGLYLVDFESPNKTRTAKDSAKLYSKVIASRRL-PE 120 GY RFGL VDF + +TR K+SA+ YS + L PE Sbjct: 429 GYRLRFGLCGVDFTAAARTRYLKNSARWYSGFLRGGELRPE 469 >04_04_0495 - 25623562-25623775,25623902-25624004,25624129-25624231, 25624353-25624562 Length = 209 Score = 31.5 bits (68), Expect = 0.13 Identities = 16/41 (39%), Positives = 23/41 (56%) Frame = +1 Query: 1 GYVSRFGLYLVDFESPNKTRTAKDSAKLYSKVIASRRLPED 123 GY +FGLY VDF++ + R K SAK Y + + +D Sbjct: 161 GYTIKFGLYHVDFDT--QERIPKMSAKWYRDFLTGSNVTDD 199 >04_04_0496 + 25631832-25631972,25632094-25632160,25634993-25635054, 25636173-25636248,25636355-25636429,25637768-25637825, 25637955-25638207,25639030-25639037,25639159-25639411, 25639503-25639605,25639750-25639852,25639947-25640160 Length = 470 Score = 30.7 bits (66), Expect = 0.23 Identities = 16/40 (40%), Positives = 23/40 (57%) Frame = +1 Query: 1 GYVSRFGLYLVDFESPNKTRTAKDSAKLYSKVIASRRLPE 120 GY +FGLY VDF++ + R + SAK Y + S L + Sbjct: 422 GYTVKFGLYQVDFDT--QERIPRMSAKWYRDFLTSSSLTD 459 >03_02_0139 - 5844107-5844278,5844413-5844521,5844630-5844732, 5844834-5844865,5845211-5845434,5845774-5845889, 5845997-5846252,5846720-5846807,5846891-5846962, 5847096-5847171,5847302-5847360,5848202-5848268, 5848760-5848825,5850466-5850657 Length = 543 Score = 30.3 bits (65), Expect = 0.30 Identities = 14/33 (42%), Positives = 21/33 (63%) Frame = +1 Query: 1 GYVSRFGLYLVDFESPNKTRTAKDSAKLYSKVI 99 GY SRFGLY VD++ N R K+S + + ++ Sbjct: 510 GYSSRFGLYFVDYKD-NLKRYPKNSVQWFKALL 541 >07_03_1537 + 27562097-27562340,27562436-27562494,27562605-27562680, 27562776-27562847,27562934-27563021,27563118-27563361, 27563490-27563605,27563783-27564000,27564113-27564144, 27564262-27564364,27564471-27564751 Length = 510 Score = 29.9 bits (64), Expect = 0.40 Identities = 14/37 (37%), Positives = 24/37 (64%) Frame = +1 Query: 1 GYVSRFGLYLVDFESPNKTRTAKDSAKLYSKVIASRR 111 GY SRFG+ VD+++ R KDSA + +++S++ Sbjct: 474 GYTSRFGIVYVDYKT--LKRYPKDSAFWFKNMLSSKK 508 >05_04_0039 + 17421826-17421966,17422105-17422168,17422562-17422620, 17423410-17423536,17425029-17425116,17425196-17425451, 17425565-17425680,17426232-17426328,17426636-17426771, 17426892-17426979,17427133-17427367 Length = 468 Score = 28.3 bits (60), Expect = 1.2 Identities = 17/45 (37%), Positives = 25/45 (55%), Gaps = 4/45 (8%) Frame = +1 Query: 1 GYVS-RFGLYLVDFESPNKTRTAKDSAKLYSKVIASR---RLPED 123 GY + FGL VDF+S + R + SA YS+ + + R+ ED Sbjct: 413 GYSTWHFGLVAVDFDSEKRRRQPRRSASWYSEFLKNNSVIRVEED 457 >05_04_0036 + 17386160-17386318,17386588-17386651,17387089-17387147, 17387268-17387343,17387521-17387592,17387786-17387873, 17387992-17388250,17388446-17388561,17388876-17389096, 17389196-17389224,17389285-17389420,17389567-17389651, 17389735-17389963 Length = 530 Score = 28.3 bits (60), Expect = 1.2 Identities = 13/29 (44%), Positives = 17/29 (58%) Frame = +1 Query: 4 YVSRFGLYLVDFESPNKTRTAKDSAKLYS 90 Y + FG+ VDF S TR + SA+ YS Sbjct: 478 YKAHFGIVAVDFGSEELTRQPRRSARWYS 506 >04_04_0219 - 23703579-23703747,23703836-23703944,23704170-23704272, 23704365-23704396,23704855-23705072,23706295-23706618, 23706982-23707069,23707179-23707263 Length = 375 Score = 27.9 bits (59), Expect = 1.6 Identities = 13/33 (39%), Positives = 21/33 (63%) Frame = +1 Query: 1 GYVSRFGLYLVDFESPNKTRTAKDSAKLYSKVI 99 GY RFG+ VD+++ K R K+SA+ + K + Sbjct: 342 GYTVRFGINFVDYDNGMK-RYPKNSARWFKKFL 373 >08_01_0869 + 8487518-8487697,8487792-8488127,8488211-8488410, 8488586-8488973 Length = 367 Score = 27.5 bits (58), Expect = 2.1 Identities = 12/35 (34%), Positives = 17/35 (48%) Frame = +1 Query: 31 VDFESPNKTRTAKDSAKLYSKVIASRRLPEDYNPD 135 +D E K + D+ K+Y SRR P Y P+ Sbjct: 329 LDEEGKQKLKDVDDNYKIYDYCTDSRRYPNGYPPE 363 >04_04_0221 - 23710739-23710964,23711050-23711158,23711371-23711473, 23711568-23711599,23711707-23711924,23711994-23712109, 23714696-23714843,23715713-23715800,23715935-23716019 Length = 374 Score = 27.5 bits (58), Expect = 2.1 Identities = 13/33 (39%), Positives = 20/33 (60%) Frame = +1 Query: 1 GYVSRFGLYLVDFESPNKTRTAKDSAKLYSKVI 99 GY RFG+ VD++ K R K+SA+ + K + Sbjct: 322 GYTVRFGINFVDYDDGMK-RYPKNSARWFKKFL 353 >04_04_0498 - 25654988-25655168,25658149-25658257,25658376-25658478, 25658634-25658883,25659011-25659126,25659332-25659587, 25659713-25659800,25659951-25660025,25660143-25660218, 25660308-25660366,25660972-25661038,25668502-25668810 Length = 562 Score = 27.1 bits (57), Expect = 2.8 Identities = 13/33 (39%), Positives = 20/33 (60%) Frame = +1 Query: 1 GYVSRFGLYLVDFESPNKTRTAKDSAKLYSKVI 99 GY RFGLY +D+ + + R+ K SA Y + + Sbjct: 525 GYTLRFGLYYIDYRT--QERSPKLSALWYKEFL 555 >04_04_0216 - 23691007-23691187,23691273-23691381,23691627-23691729, 23691829-23691860,23692012-23692229,23692299-23692420 Length = 254 Score = 27.1 bits (57), Expect = 2.8 Identities = 14/33 (42%), Positives = 19/33 (57%) Frame = +1 Query: 1 GYVSRFGLYLVDFESPNKTRTAKDSAKLYSKVI 99 GY RFGL VD++ K R K+SA + K + Sbjct: 217 GYTLRFGLNFVDYDDGMK-RHPKNSAHWFKKFL 248 >01_05_0062 + 17755460-17755522,17756878-17756953,17757074-17757145, 17757274-17757361,17757793-17758033,17759461-17759576, 17759804-17760021,17760210-17760241,17760338-17760440, 17760531-17760805 Length = 427 Score = 27.1 bits (57), Expect = 2.8 Identities = 15/36 (41%), Positives = 21/36 (58%) Frame = +1 Query: 1 GYVSRFGLYLVDFESPNKTRTAKDSAKLYSKVIASR 108 GY SRFGL VDF + R K SA + +++S+ Sbjct: 393 GYTSRFGLVYVDFRT--LRRYPKMSAYWFRDLVSSK 426 >03_05_0833 - 28045442-28045881,28045961-28046063,28046172-28046203, 28046299-28046516,28046606-28046721,28047757-28048000, 28048423-28048510,28048596-28048667,28048758-28048869, 28049047-28049115,28049627-28049685,28050067-28050325 Length = 603 Score = 26.6 bits (56), Expect = 3.7 Identities = 13/33 (39%), Positives = 19/33 (57%) Frame = +1 Query: 1 GYVSRFGLYLVDFESPNKTRTAKDSAKLYSKVI 99 GY S+FG+ VDF + R KDSA + ++ Sbjct: 514 GYTSKFGIVYVDFTT--LKRYPKDSANWFKNML 544 >01_06_1668 + 38998348-38998434,38999234-38999300,38999377-38999435, 38999636-38999711,38999856-38999930,39000007-39000094, 39000261-39000486,39000689-39000804,39001172-39001383, 39001882-39001916,39002005-39002107,39002645-39002753, 39002838-39003036 Length = 483 Score = 26.6 bits (56), Expect = 3.7 Identities = 12/33 (36%), Positives = 21/33 (63%) Frame = +1 Query: 1 GYVSRFGLYLVDFESPNKTRTAKDSAKLYSKVI 99 GY RFG+ VD+++ +R K SA+ +S+ + Sbjct: 440 GYTKRFGIVYVDYKN-GLSRHPKASARWFSRFL 471 >01_01_0850 - 6641980-6642163,6642791-6644091 Length = 494 Score = 26.6 bits (56), Expect = 3.7 Identities = 13/36 (36%), Positives = 21/36 (58%) Frame = +3 Query: 9 VPLRSVSGRFRKSQQNENGKGFGQAVLQGDCESTPA 116 +P+R V + RK + ++ G GFG+ + STPA Sbjct: 246 IPIREVVKKMRKERASKGGGGFGET----NGSSTPA 277 >04_04_0223 - 23723055-23723223,23723316-23723424,23723588-23723690, 23723781-23723812,23724024-23724241,23724322-23724437, 23725055-23725310,23725719-23725806,23725928-23726005, 23726199-23726274,23726525-23726583,23727715-23728066 Length = 551 Score = 26.2 bits (55), Expect = 4.9 Identities = 13/33 (39%), Positives = 18/33 (54%) Frame = +1 Query: 1 GYVSRFGLYLVDFESPNKTRTAKDSAKLYSKVI 99 GY RFG+ VD+ K R K+SA + K + Sbjct: 518 GYTVRFGINFVDYNDGRK-RYPKNSAHWFKKFL 549 >05_04_0038 + 17403620-17403769,17403975-17404038,17404807-17404865, 17404981-17405056,17405196-17405267,17405411-17405498, 17405617-17405872,17405972-17406087,17406757-17406977, 17407074-17407102,17407192-17407291,17407405-17407492, 17407640-17407874 Length = 517 Score = 25.4 bits (53), Expect = 8.6 Identities = 20/57 (35%), Positives = 27/57 (47%), Gaps = 1/57 (1%) Frame = +1 Query: 1 GYVS-RFGLYLVDFESPNKTRTAKDSAKLYSKVIASRRLPEDYNPDDFSAFNSAGSH 168 GY S +GL VDF S + R + SA YS + + +D +F SA SH Sbjct: 462 GYNSWHYGLVAVDFGSTERRRQPRRSASWYSDFLKNN---APIRVED-GSFVSAASH 514 >01_01_0201 + 1746088-1747086,1748735-1748806,1750106-1750168, 1750355-1750489,1750604-1750669 Length = 444 Score = 25.4 bits (53), Expect = 8.6 Identities = 12/36 (33%), Positives = 19/36 (52%) Frame = +1 Query: 40 ESPNKTRTAKDSAKLYSKVIASRRLPEDYNPDDFSA 147 E+ N+T D + Y ++ +LP D +P DF A Sbjct: 232 EATNETAELPDDPEFYKDILRGLQLP-DIDPMDFRA 266 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 6,071,671 Number of Sequences: 37544 Number of extensions: 86564 Number of successful extensions: 244 Number of sequences better than 10.0: 27 Number of HSP's better than 10.0 without gapping: 243 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 244 length of database: 14,793,348 effective HSP length: 71 effective length of database: 12,127,724 effective search space used: 351703996 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -