BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30945 (623 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_18968| Best HMM Match : HMG_box (HMM E-Value=1.2e-19) 46 3e-05 SB_21901| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.11 SB_23256| Best HMM Match : HMG_box (HMM E-Value=3.3e-22) 32 0.33 SB_8014| Best HMM Match : HMG_box (HMM E-Value=0.00031) 31 0.76 SB_46509| Best HMM Match : HMG_box (HMM E-Value=4.2e-10) 31 1.0 SB_57482| Best HMM Match : Thyroglobulin_1 (HMM E-Value=0) 31 1.0 SB_12182| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.0 SB_2908| Best HMM Match : HMG_box (HMM E-Value=1.5e-08) 30 1.8 SB_12646| Best HMM Match : SSrecog (HMM E-Value=0) 30 1.8 SB_48962| Best HMM Match : Cadherin (HMM E-Value=0) 29 2.3 SB_59680| Best HMM Match : Extensin_2 (HMM E-Value=1.2) 29 2.3 SB_20899| Best HMM Match : RRM_1 (HMM E-Value=2.3e-15) 29 3.1 SB_37758| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.1 SB_8083| Best HMM Match : Lectin_C (HMM E-Value=3.8e-22) 28 5.4 SB_57860| Best HMM Match : DUF1226 (HMM E-Value=1.5e-07) 28 7.1 SB_8046| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.1 SB_26162| Best HMM Match : HMG_box (HMM E-Value=1.5e-31) 27 9.4 SB_24803| Best HMM Match : LRR_1 (HMM E-Value=0.0066) 27 9.4 SB_23499| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.4 SB_22635| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.4 >SB_18968| Best HMM Match : HMG_box (HMM E-Value=1.2e-19) Length = 1204 Score = 45.6 bits (103), Expect = 3e-05 Identities = 19/34 (55%), Positives = 23/34 (67%) Frame = +2 Query: 8 QNPNASFGEVSKIVASMWDGLDSEHKSVYKQKTE 109 QNP+A FGE++KIV MW+ L E K VY K E Sbjct: 946 QNPSAQFGEIAKIVGQMWENLPEEQKKVYHCKHE 979 >SB_21901| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 192 Score = 33.9 bits (74), Expect = 0.11 Identities = 13/32 (40%), Positives = 20/32 (62%) Frame = +2 Query: 2 KGQNPNASFGEVSKIVASMWDGLDSEHKSVYK 97 K NPNAS G +SK++ MW + + K+ Y+ Sbjct: 121 KKDNPNASGGALSKVLGEMWSKMTDDDKTQYQ 152 >SB_23256| Best HMM Match : HMG_box (HMM E-Value=3.3e-22) Length = 523 Score = 32.3 bits (70), Expect = 0.33 Identities = 11/36 (30%), Positives = 23/36 (63%) Frame = +2 Query: 2 KGQNPNASFGEVSKIVASMWDGLDSEHKSVYKQKTE 109 + +NP+ F EV++I+ +MW L + K ++ ++ E Sbjct: 196 RSENPDLPFHEVTRILGNMWSQLPTPQKQLFLEEAE 231 >SB_8014| Best HMM Match : HMG_box (HMM E-Value=0.00031) Length = 406 Score = 31.1 bits (67), Expect = 0.76 Identities = 13/34 (38%), Positives = 19/34 (55%) Frame = +2 Query: 8 QNPNASFGEVSKIVASMWDGLDSEHKSVYKQKTE 109 +NP+ +V KI W GLDS K V+ +K + Sbjct: 350 ENPDIPDEDVVKIAMKTWKGLDSVEKKVWNEKAK 383 >SB_46509| Best HMM Match : HMG_box (HMM E-Value=4.2e-10) Length = 145 Score = 30.7 bits (66), Expect = 1.0 Identities = 9/35 (25%), Positives = 21/35 (60%) Frame = +2 Query: 8 QNPNASFGEVSKIVASMWDGLDSEHKSVYKQKTEI 112 ++P +FGE+S+++ W + K+ Y+ K ++ Sbjct: 56 EHPEYAFGEISRLIGEEWRNASAARKAEYENKAQM 90 >SB_57482| Best HMM Match : Thyroglobulin_1 (HMM E-Value=0) Length = 789 Score = 30.7 bits (66), Expect = 1.0 Identities = 19/64 (29%), Positives = 27/64 (42%) Frame = +3 Query: 426 PSQYDNCSPNIPECSSPITTGLSNKLFKSNQNCQPNVAQSPRNYQPTQSPTNYPASSSMS 605 P+ Y +P S+ T ++ + N P A Y P SP +YPASS S Sbjct: 415 PAPYQAPAPETYAASANTTAA---EISQQNYTASPTAAYPA--YYPASSPVSYPASSPAS 469 Query: 606 PPGY 617 P + Sbjct: 470 YPAF 473 Score = 27.9 bits (59), Expect = 7.1 Identities = 14/25 (56%), Positives = 16/25 (64%) Frame = +3 Query: 537 AQSPRNYQPTQSPTNYPASSSMSPP 611 A SP +Y P SP +YPASS S P Sbjct: 464 ASSPASY-PAFSPASYPASSPASYP 487 >SB_12182| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1361 Score = 30.7 bits (66), Expect = 1.0 Identities = 9/35 (25%), Positives = 21/35 (60%) Frame = +2 Query: 8 QNPNASFGEVSKIVASMWDGLDSEHKSVYKQKTEI 112 ++P +FGE+S+++ W + K+ Y+ K ++ Sbjct: 1289 EHPEYAFGEISRLIGEEWRNASAARKAEYENKAQM 1323 >SB_2908| Best HMM Match : HMG_box (HMM E-Value=1.5e-08) Length = 324 Score = 29.9 bits (64), Expect = 1.8 Identities = 11/28 (39%), Positives = 15/28 (53%) Frame = +2 Query: 2 KGQNPNASFGEVSKIVASMWDGLDSEHK 85 K QNP+ ++ KI+ MW LD K Sbjct: 47 KNQNPDFKLWDIGKIIGQMWRDLDDAEK 74 >SB_12646| Best HMM Match : SSrecog (HMM E-Value=0) Length = 783 Score = 29.9 bits (64), Expect = 1.8 Identities = 15/37 (40%), Positives = 20/37 (54%) Frame = +2 Query: 2 KGQNPNASFGEVSKIVASMWDGLDSEHKSVYKQKTEI 112 K +NP S EVSK+ MW L KS +++K I Sbjct: 561 KDKNPGISVTEVSKVAGEMWKNLTD--KSKWEEKAAI 595 >SB_48962| Best HMM Match : Cadherin (HMM E-Value=0) Length = 2225 Score = 29.5 bits (63), Expect = 2.3 Identities = 17/52 (32%), Positives = 26/52 (50%) Frame = +3 Query: 429 SQYDNCSPNIPECSSPITTGLSNKLFKSNQNCQPNVAQSPRNYQPTQSPTNY 584 S YD P +P+ SS + + ++ P V Q PRNY+P++S Y Sbjct: 2018 SMYDG--PQVPKRSSSLMSS------SDEEDDIPEVPQRPRNYRPSESEDGY 2061 >SB_59680| Best HMM Match : Extensin_2 (HMM E-Value=1.2) Length = 412 Score = 29.5 bits (63), Expect = 2.3 Identities = 17/58 (29%), Positives = 25/58 (43%), Gaps = 1/58 (1%) Frame = +3 Query: 447 SPNIPECSSPITTGLSNKLFKSNQN-CQPNVAQSPRNYQPTQSPTNYPASSSMSPPGY 617 SP +SP + +S + N CQ A S P ++P PA ++ PGY Sbjct: 26 SPYASAMASPYASAMSAPCVPTPANPCQTPAAASQARPAPGRAPARNPAQQRVNLPGY 83 >SB_20899| Best HMM Match : RRM_1 (HMM E-Value=2.3e-15) Length = 876 Score = 29.1 bits (62), Expect = 3.1 Identities = 12/29 (41%), Positives = 17/29 (58%) Frame = +3 Query: 528 PNVAQSPRNYQPTQSPTNYPASSSMSPPG 614 P A +P+ Y P+ +PT Y A +PPG Sbjct: 715 PAAAAAPQGYPPSSAPTGYQARGP-APPG 742 >SB_37758| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 382 Score = 28.7 bits (61), Expect = 4.1 Identities = 11/36 (30%), Positives = 21/36 (58%) Frame = +2 Query: 2 KGQNPNASFGEVSKIVASMWDGLDSEHKSVYKQKTE 109 K Q+P+ +F E++K++ W+ L E K + + E Sbjct: 216 KHQHPHLTFPEITKMLGQEWNSLLPEEKQKFLDEAE 251 >SB_8083| Best HMM Match : Lectin_C (HMM E-Value=3.8e-22) Length = 3445 Score = 28.3 bits (60), Expect = 5.4 Identities = 16/34 (47%), Positives = 19/34 (55%), Gaps = 1/34 (2%) Frame = +3 Query: 171 VENKKTKQCTT-TLIMVMCVELTVAPHTVLLPRT 269 V+ KTKQ TT T E TVAP T ++P T Sbjct: 1685 VDQLKTKQPTTATAKTTAAPETTVAPETTVVPET 1718 >SB_57860| Best HMM Match : DUF1226 (HMM E-Value=1.5e-07) Length = 754 Score = 27.9 bits (59), Expect = 7.1 Identities = 15/52 (28%), Positives = 20/52 (38%) Frame = +3 Query: 462 ECSSPITTGLSNKLFKSNQNCQPNVAQSPRNYQPTQSPTNYPASSSMSPPGY 617 +CS P TG S + K + QP+ + SP A P GY Sbjct: 342 QCSPPSRTGRSKTIHKRPRMTQPDSRNVSSTSRDKSSPDESSARGFTRPDGY 393 >SB_8046| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1304 Score = 27.9 bits (59), Expect = 7.1 Identities = 14/57 (24%), Positives = 24/57 (42%) Frame = +3 Query: 438 DNCSPNIPECSSPITTGLSNKLFKSNQNCQPNVAQSPRNYQPTQSPTNYPASSSMSP 608 D C P C I + +F NCQ + +S ++ P +PA++ +P Sbjct: 1202 DTCDPESGVC---IDCQHNTTVFNLRFNCQVTIVRSAQSVSMATPPMEHPATAESAP 1255 >SB_26162| Best HMM Match : HMG_box (HMM E-Value=1.5e-31) Length = 367 Score = 27.5 bits (58), Expect = 9.4 Identities = 10/34 (29%), Positives = 19/34 (55%) Frame = +2 Query: 8 QNPNASFGEVSKIVASMWDGLDSEHKSVYKQKTE 109 +NP E+SK++ W+ L ++ K + +K E Sbjct: 115 ENPKLHNAEISKLLGKAWNELTTKDKRPFVEKAE 148 >SB_24803| Best HMM Match : LRR_1 (HMM E-Value=0.0066) Length = 727 Score = 27.5 bits (58), Expect = 9.4 Identities = 11/35 (31%), Positives = 20/35 (57%) Frame = +3 Query: 510 SNQNCQPNVAQSPRNYQPTQSPTNYPASSSMSPPG 614 ++Q+ +P + +SP +P Q+P N P +S G Sbjct: 656 NDQSAEPRIKKSPVASRPGQAPVNLPHMDPVSLAG 690 >SB_23499| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 27.5 bits (58), Expect = 9.4 Identities = 17/62 (27%), Positives = 24/62 (38%) Frame = +3 Query: 426 PSQYDNCSPNIPECSSPITTGLSNKLFKSNQNCQPNVAQSPRNYQPTQSPTNYPASSSMS 605 PS + + P+I S P + S + A P + QP P + PAS S Sbjct: 31 PSIHPSIHPSIQPASQPASQPASQPASQPASQPASQPASQPAS-QPASQPASQPASQPAS 89 Query: 606 PP 611 P Sbjct: 90 QP 91 >SB_22635| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 409 Score = 27.5 bits (58), Expect = 9.4 Identities = 10/34 (29%), Positives = 19/34 (55%) Frame = +1 Query: 106 RNSKKRIP*GSCCLQSQSSIKGWRTRKPSNVQPH 207 R KK + + ++ + ++KGWR + PS + H Sbjct: 354 RPRKKAVDTSNMYVRGEENLKGWRPKGPSLIDEH 387 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,306,618 Number of Sequences: 59808 Number of extensions: 317966 Number of successful extensions: 1156 Number of sequences better than 10.0: 20 Number of HSP's better than 10.0 without gapping: 837 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1143 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1548368000 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -